KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328506Help
Entry
4328506           CDS       T01015                                 

Definition
Os02g0180100
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4328506
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   4328506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 329 aa AA seqDB search
MSWAAIENDPGIFTELLQQMQLKGLQVDELYSLDLDALNDLQPVYGLIVLYKWQPPEKDE
RPIKDPIPNLFFAKQIINNACATQAIVSVLLNSPGITLSEELKKLKEFAKDLPPDLKGLA
IVNSESIRLASNSFARPEVPEEQKSSVKDDDVYHFISYVPVDGVLYELDGLKEGPISLGK
CPGGVGDIGWLRMVQPVIQERIDRFSQNEIRFSVMAILKNRREKFTLELKELQRKRENLL
AQMGDPSANRHAPSVEHSLAEVAAHIEAVTEKIIMEEEKWKKWKTENIRRKHNYVPFLFN
FLKILEERQQLKPLIEKAKQKSHSSANPR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggctgcaatcgagaatgatcctggcatttttactgaactgttgcaacagatg
caactgaagggtcttcaagttgatgaactctattcactcgatctggatgccctcaatgat
cttcagccagtttatgggctcattgtgctgtacaaatggcaacctccagaaaaagatgag
cgtcctatcaaggacccaatcccaaaccttttctttgctaagcagataattaacaatgca
tgtgccacccaagctatcgtttctgttctattaaactctccgggtatcacccttagtgag
gagctcaaaaagctaaaggagtttgcaaaggacttgccaccagatctcaaaggattggct
atagtcaattctgagagcatccgtttggccagtaattcatttgcaaggccggaagtcccc
gaggagcagaaatcatctgtcaaggatgatgatgtctaccatttcattagctatgttcct
gtggacggtgtcctgtatgagcttgatgggctaaaggaagggccaataagcctggggaaa
tgcccaggtggcgttggcgacataggttggctgaggatggtgcagcctgtcattcaggaa
cgcatcgatcggttctctcagaatgagataaggttcagcgtcatggctatcctaaagaac
cggagggagaagttcactttagaactcaaggagcttcagaggaagagggagaacctcctg
gcacagatgggtgatccttccgccaataggcacgcgccatctgttgagcactctcttgcg
gaggttgctgctcatattgaggctgtaacagagaagatcataatggaggaagagaagtgg
aagaagtggaagacagagaacatcaggaggaagcacaactatgtgccattcttgttcaat
ttcctcaagattcttgaggagaggcagcagttgaagcccctgatagagaaggcgaaacag
aagtctcacagctctgctaatcctaggtga

DBGET integrated database retrieval system