KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328655Help
Entry
4328655           CDS       T01015                                 

Definition
Os02g0202300
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:osa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 406 aa AA seqDB search
MPPPPPPRELLAVVEAALLGPSPPSPAQRVELLHAVRDAAPAFRALLSYPGPKASDRTQV
EAKEVRLPDMPPITLDDTDVQTALKLSDELNLNEIECVRLLVDANREWVLYGREPLEIYR
LAAGLWYMERRDLITSLYILLRSVVLDQGLDADLMYEIQNQMEALFIEGLGQRIITLVKE
LNREESTGVGQPSSEHYVLDFRGALVERRAIVSRERLSLSHCLALSALIKLMSPREVKDV
FSLLKDCAAEVNENSSVELQITYGVLFSLVVTFVSDALSTSHEKPSLSSSDSSFRRDFHE
LVMRSDNNLTIEGFVGVVRLAWAVHLMLTQDRSSARDTLTSSSRDVTDIWACLEIICRQN
SFQFLQERIMQTAAYKNDDEDIVYMYTGYMHKLMMCFLSHPTSRDK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgccgcccccgccgcgcgagctcctggccgtcgtcgaggcggcgctgctcggg
ccatccccgccgtcgccggcgcagcgcgtggagctcctccacgccgtccgcgatgccgcc
cccgcattccgcgcgctcctctcctacccggggccgaaggcgtcggatcggactcaggtg
gaggccaaggaagtgcggctcccggacatgcctcccataacgctcgatgacaccgacgtg
cagacggccctgaaattgagtgatgaactcaatcttaatgagattgagtgtgttcgattg
ctagttgacgccaacagggagtgggttctatatggccgagagccactggaaatatatagg
ctcgcagctggcctttggtacatggagagaagggatcttataacctctttgtacattctg
ttacggtctgttgtacttgaccaagggcttgatgctgatctgatgtatgaaatacaaaac
caaatggaggctctatttattgagggtctcgggcagcgtataattacactagtaaaggaa
cttaatcgtgaagaatcaactggtgttggccaaccaagctctgagcattatgtgcttgat
ttcagaggggctcttgtggagaggcgtgccattgtttctcgcgagagattaagtttgagc
cactgccttgctctttctgcacttattaaattgatgagtcccagggaggttaaggatgta
ttttcattgttaaaagactgtgcagctgaagttaatgaaaattctagcgtggagcttcag
atcacctatggcgttcttttttctcttgtagtaacttttgtttctgatgccttaagtact
tcccatgagaaaccatctttgtcatcttccgattcttcgttcaggcgtgattttcatgag
ctggtgatgaggtcagataacaatttgactattgaaggatttgttggtgttgtgcgactt
gcatgggcagttcatttgatgttaactcaagatcgaagcagtgcaagagatactctcact
agttcttcgagagatgtgacagatatatgggcatgtctggagataatctgtcgccagaat
agttttcaatttttgcaggaacgtattatgcaaacagctgcctacaagaatgacgatgag
gacattgtttacatgtacactggctacatgcacaagttgatgatgtgctttctttcccat
ccaacttctagagacaag

DBGET integrated database retrieval system