KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328655Help
Entry
4328655           CDS       T01015                                 

Definition
(RefSeq) nuclear pore complex protein NUP205
  KO
K14310  
nuclear pore complex protein Nup205
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    4328655
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     4328655
Chromosome [BR:osa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    4328655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 1849 aa AA seqDB search
MPPPPPPRELLAVVEAALLGPSPPSPAQRVELLHAVRDAAPAFRALLSYPGPKASDRTQV
EAKEVRLPDMPPITLDDTDVQTALKLSDELNLNEIECVRLLVDANREWVLYGREPLEIYR
LAAGLWYMERRDLITSLYILLRSVVLDQGLDADLMYEIQNQMEALFIEGLGQRIITLVKE
LNREESTGVGQPSSEHYVLDFRGALVERRAIVSRERLSLSHCLALSALIKLMSPREVKDV
FSLLKDCAAEVNENSSVELQITYGVLFSLVVTFVSDALSTSHEKPSLSSSDSSFRRDFHE
LVMRSDNNLTIEGFVGVVRLAWAVHLMLTQDRSSARDTLTSSSRDVTDIWACLEIICRQN
SFQFLQERIMQTAAYKNDDEDIVYMYTGYMHKLMMCFLSHPTSRDKIKEIKEKTMNALSP
YGSIRDHREDPSRTGEQIGQPTNQPFISLLELVREIYQKEPELVHGNEELWTFVISAGED
HTNTLTLVAFLGLLSTLASSEVGAAKVYELLQGKVYRSLGWSTLFDCLSIYEEKFKESLQ
SSASVMPEFPEADAQALVSYLAVLQKVVENGNTTERRKWFPDIEPLFKLLSYENVPPFLK
GALRNSITAFIKVSPLLKDAIWSYLEQYDLPVVTPPLGQHNATQIYDMRFELNEVEAMRE
SYPSTISFLNLVNALIAEERNISDKGRRFMGIFKFVYEDVFGPFPQRAYADPREKWELAV
ACLEHFRMVLSMYDIKDDDIYAAVNASGPSTTSHASIDRQLPVLELLKDFMSGKVAFRNI
MNIVSVGVDTLINERTTQTYGILLEKTVHLSFEIFILVMERDLVLADVFRPLYQPLDVVL
AQNHRHIIALLEFVRYDYLPQIQQCSIKIMGILSSRIVGLVQLLLKADVAKSVIEDYAAC
LEFRFDDFQAIENTKDDVGVLILQLLIDNICRPAPNITHLLLRFDVNGSIERTVLKPKSH
YSCLKTILDNLEKVTKPDINALLHEFGFQLLYELCLDPLTCGPVMDLLSTTKYQFFSKHV
GTIGVSPLPRRNNNQSLRISMLHERAWLLKMLALALHVSDISSSLYRESCLAILCHTFGH
CAENLRSANLLQSPGSSNLAMNGNKVLDLLEVVQFRCPDTSIKYPQMLSNLRLESKIEEI
LRNSATSEFGGVYYYSERGDRLIDLDAFHEKLLQMSQLLNPQLSESEKSELKESFHQMLK
WAWRYNKNLEEQAAQLHMLTGWSQIVEIAVSRRMSLLEDRSHLLFELLDASLSATTSPDC
SVKMAYILTNVALTCMAKLRDERFICPTGADSDAVTCLDIISAKQLSNAACTSLLFKLTM
AILRNESSETLRRRQYALLLSYFQYCRSTLDSDVPPPVLRFLLLEEQEGDDDELGLQKVL
KEQNELARSNFSIIRKEAQAVIDLVAKDAIHGSEAGKAISFYVLDSLISIDHDKYFLNQI
QSRGILRSCLSDVNNYLSKEASFSSESSQRFCTIDAQLSLLLRISHHYGKHGSQILLSMG
ALHNLSSCNLMGSQKKANSRLNSNVVKERAGEIDKRRSLTAPILRIVTSFTSLVDSADFL
EVKNKIVRELVDFAKQHQPVFNIILRESISGANIFNLERLNMVVSILGKVWAYEENDECS
FVQDLFSMMQFLFSLDIGSLNFMQSSNMIENQKSELIVFALCFSLISYLYVLATKKDMRF
QISYDDTTEGQQQPTLQLISDLLNSITVAMERVAEEKYMLLNKIRDLNELSRKEVDDIIK
LCMKQDCISPNDNIRKRRFIAMIELCCMAGNRGQLITLLLQIAECAVTILLVHFQDESCA
KDISSFSDELLPILERLEHFTEDKVGRSLKLFHRSVTTLKEMTIRSMSL
NT seq 5550 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgccgcccccgccgcgcgagctcctggccgtcgtcgaggcggcgctgctcggg
ccatccccgccgtcgccggcgcagcgcgtggagctcctccacgccgtccgcgatgccgcc
cccgcattccgcgcgctcctctcctacccggggccgaaggcgtcggatcggactcaggtg
gaggccaaggaagtgcggctcccggacatgcctcccataacgctcgatgacaccgacgtg
cagacggccctgaaattgagtgatgaactcaatcttaatgagattgagtgtgttcgattg
ctagttgacgccaacagggagtgggttctatatggccgagagccactggaaatatatagg
ctcgcagctggcctttggtacatggagagaagggatcttataacctctttgtacattctg
ttacggtctgttgtacttgaccaagggcttgatgctgatctgatgtatgaaatacaaaac
caaatggaggctctatttattgagggtctcgggcagcgtataattacactagtaaaggaa
cttaatcgtgaagaatcaactggtgttggccaaccaagctctgagcattatgtgcttgat
ttcagaggggctcttgtggagaggcgtgccattgtttctcgcgagagattaagtttgagc
cactgccttgctctttctgcacttattaaattgatgagtcccagggaggttaaggatgta
ttttcattgttaaaagactgtgcagctgaagttaatgaaaattctagcgtggagcttcag
atcacctatggcgttcttttttctcttgtagtaacttttgtttctgatgccttaagtact
tcccatgagaaaccatctttgtcatcttccgattcttcgttcaggcgtgattttcatgag
ctggtgatgaggtcagataacaatttgactattgaaggatttgttggtgttgtgcgactt
gcatgggcagttcatttgatgttaactcaagatcgaagcagtgcaagagatactctcact
agttcttcgagagatgtgacagatatatgggcatgtctggagataatctgtcgccagaat
agttttcaatttttgcaggaacgtattatgcaaacagctgcctacaagaatgacgatgag
gacattgtttacatgtacactggctacatgcacaagttgatgatgtgctttctttcccat
ccaacttctagagacaagataaaggaaataaaggaaaaaacaatgaatgccctcagtcca
tatgggtcaataagagatcatagagaagaccctagcagaactggagaacaaattggccag
cctaccaatcagcctttcatatctctcctggaattagttagagaaatataccagaaagaa
cctgagctagtgcatggaaacgaggaactttggacctttgtcatatctgcaggagaagat
cacaccaatacactaactcttgtggcattccttggacttcttagtactttggcttccagt
gaagttggtgctgccaaagtctacgaactgctccagggaaaagtttaccgttcacttggt
tggagcactttgtttgattgcttatctatttatgaagaaaagttcaaagaatcccttcaa
tcttctgcaagcgtgatgcctgagtttcctgaagcggatgcacaggcacttgtttcgtat
ttagctgttctccagaaggttgttgaaaatgggaatactactgaaagaaggaaatggttc
cctgatattgagcctttgtttaagctcctcagctatgaaaatgtaccaccatttttgaag
ggggctttgaggaattcgatcactgcatttatcaaagtatcaccgctgttgaaggatgct
atttggagttatcttgaacaatatgatcttccggtggttacgcctccacttggtcagcat
aatgcaacacagatctatgacatgaggtttgagttgaatgaagttgaagcaatgagggag
agttatccatccacaatatcatttctcaacttagtcaatgctctaattgcagaagaaaga
aacataagtgacaagggccggaggtttatgggtatatttaagtttgtttacgaagatgta
tttgggcctttccctcaaagagcctatgccgatcctcgggagaagtgggaactggcagtt
gcttgcttggagcacttccgcatggttttaagcatgtatgacatcaaggatgatgatatt
tatgctgctgttaacgcatctggaccttcaacaacatctcatgcctcaatcgacagacag
ctccctgtgcttgagctactcaaagatttcatgagtgggaaagttgctttccggaatatt
atgaacatcgtatcagtgggtgtggacactcttattaatgagcgaactacccaaacttat
gggattcttctggagaaaactgtccatctatcatttgaaatatttattcttgtgatggag
agagatctggtgcttgctgatgttttccgtccactctaccagccgttggatgttgtgtta
gctcagaatcatagacatattatagctttactggagtttgtacgatatgattatcttcct
cagattcaacagtgctctataaaaattatgggaattctgagttctagaatagttggtctt
gtccagttgcttctgaaagcagatgttgctaaatcggtaattgaggattatgctgcttgc
ttggagttccgctttgatgatttccaggccatagagaacacaaaagatgacgttggtgtc
ctaatactacagctacttatcgacaatatttgtcgtccagctcccaacattacacatcta
ctcctaagattcgatgtcaatggatccatagaacggacagttttaaaaccaaagtcacac
tacagttgtttaaagacaattcttgacaatcttgaaaaggtgacaaagccagatataaat
gctttactgcatgaattcggttttcagcttctctacgagttatgccttgaccctttaact
tgtgggcctgtcatggatctcctgagcacaacaaaataccagttcttttctaagcatgtt
ggaaccattggtgtgtcaccacttccgagaaggaacaacaatcaatctcttcgtattagc
atgctccatgagagggcatggttgctaaagatgctagcattggcattgcatgtatctgat
atatcatcgtccttataccgggagtcctgtttggctattctatgtcatacttttggccat
tgtgctgagaacttaaggagtgcaaacctgttacaatctcctggcagtagcaatttagca
atgaatggaaacaaggttttggatttgcttgaagttgtccagttcagatgtccggacact
tccattaaatacccccagatgctttctaacctgagacttgaatcaaagattgaagagatc
ctaaggaattccgcgacatctgaatttggtggtgtatattattattcagagcgaggcgat
agattgattgatcttgatgcatttcatgaaaaacttctccagatgtctcagttattgaac
ccacaattaagtgaatctgagaaaagcgagctaaaagaatcattccatcagatgctgaaa
tgggcctggagatataacaaaaatcttgaagaacaagcagcccagcttcacatgttgact
ggctggtctcaaattgttgaaatagcagtatctagaaggatgtcattacttgaagatcgt
tctcatttattgtttgagctccttgacgcttcattaagtgccacaacatctccagattgt
tcagtgaaaatggcatatattttaaccaatgtggcattgacttgtatggcgaaactgcgg
gatgaaagattcatatgcccaaccggtgccgattctgatgcagttacttgccttgacatc
atttcagcaaagcagttgtcaaatgcagcctgcacttcattattgttcaaactcacgatg
gcaatactaagaaatgaatcttctgagaccttgagaagacgccaatatgcattactgtta
agttattttcagtactgccgtagcacccttgactctgatgtccctccaccagttcttcgg
ttcttactacttgaagaacaagagggagatgatgatgaacttggtcttcaaaaggttctc
aaggaacaaaatgaattagcacgcagcaacttctctatcataaggaaggaagctcaagca
gttattgatttggttgccaaggatgcgatccatggaagtgaagcagggaaagcaatttca
ttctacgttcttgattcactgattagtattgaccatgacaagtattttttgaaccaaatt
cagagtcgaggaattctcagatcatgtctaagtgatgttaacaactacttgtctaaggaa
gcatcattctcatcagagtcttcacagcgattttgcactattgatgctcaattgtcatta
cttctgagaatcagtcaccactatgggaaacatggctcccagattctgttgtccatgggt
gctctacataatctttcgtcgtgcaacctgatgggttcgcagaaaaaggcaaattcaagg
ctcaactccaatgtagtgaaagagcgagctggagaaattgacaagaggagatcacttact
gcaccgatacttagaatagtcacatctttcacctcacttgtggactccgctgattttctt
gaggtgaagaacaaaattgtccgggagttagtagacttcgccaagcagcatcagcctgtt
tttaatatcattttaagagagagtatatctggagctaatatattcaacttggagcggctt
aatatggtggtctctattcttggcaaggtatgggcatatgaggaaaatgatgaatgcagc
tttgtccaagatctattttccatgatgcaatttcttttcagtcttgatattgggtctctc
aactttatgcaatcatcaaacatgattgagaatcagaagtcagaattgatagtgtttgcc
ttgtgcttcagccttatctcctacctatatgttctggctacaaagaaggatatgcggttt
caaatttcgtatgatgatactactgaaggtcagcagcaaccaacactacaactgatttca
gatcttctaaactcaataacagttgctatggaaagagtagctgaagaaaaatatatgttg
ctaaataagattcgtgacttaaatgagttatctaggaaggaggttgatgatataataaaa
ttatgcatgaaacaagattgtatctctcccaacgataacatccgtaaaaggaggttcatt
gcaatgatagaattgtgttgcatggccggcaaccgaggccagctcataacccttctactc
caaatcgcagaatgcgctgtcactattctccttgttcattttcaagacgagtcttgtgca
aaagatatttcttcattttctgatgagttgcttcctatcctggagaggctagagcatttt
acggaggacaaggtcgggcgtagcctcaagctatttcaccgatctgtaaccactctaaaa
gagatgaccatcagaagcatgtcattgtga

DBGET integrated database retrieval system