KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329318Help
Entry
4329318           CDS       T01015                                 

Definition
Os02g0465400
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    4329318
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     4329318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 450 aa AA seqDB search
MAKPRASAAAAKAPASTPPKTVHSALVTYASMLSLLSLCPPFVILLWYTMVHADGSVVRA
YEHLREHGVLEGLKAIWPMPTMAAWKIIFGFGLFEAALQLLLPGKRFEGPVSPSGNVPVY
KANGLQAYAVTLITYLSLWWFGIFNPAIVYDHLGEIYSALVFGSFVFCIFLYIKGHLAPS
SSDSGSSGNVIIDFYWGMELYPRIGKHFDIKVFTNCRFGMMSWAVLAVTYCIKQYEMNGR
VADSMLVNTALMLIYVTKFFWWESGYWCTMDIAHDRAGFYICWGCLVWVPSIYTSPGMYL
VNHPVNLGPQLALSILLAGILCIYINYDCDRQRQEFRRTNGKCSIWGKAPSKIVASYQTT
NGETKSSLLLTSGWWGLSRHFHYVPEILSAFFWTVPALFDHFLPYFYVIFLTILLFDRAK
RDDDRCSSKYGKYWKMYCNKVPCRVIPGIY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcctagggcctccgccgccgcggcgaaggcgccagcctccacgccgcccaag
acggtgcactcggcgctcgtcacctacgcctccatgctctccctcctctccctctgcccg
cccttcgtcatcctcctgtggtacacgatggtgcacgcggacggatccgtggtgcgggcg
tacgagcacctccgcgagcacggggtgctggaggggctcaaggccatctggcccatgcca
accatggccgcctggaagatcatcttcggcttcggcctcttcgaggccgcgctgcagctt
ctcctccccgggaagcgcttcgagggccccgtctccccctcgggcaacgtgcccgtctac
aaggcaaatggcttacaagcatatgcagtgaccttgataacatacctgagcctgtggtgg
tttggaatttttaaccctgcaatagtatacgatcacttgggggaaatatactctgctctt
gtatttggaagctttgtgttctgtatttttctgtacataaagggtcatcttgctccatct
tcatctgattctggatcctcagggaatgtgataattgatttctactggggaatggaacta
tatcctcgcattggtaagcactttgatatcaaagtgttcacaaactgccgttttgggatg
atgtcctgggctgttcttgctgtaacctactgcataaagcagtatgaaatgaatggccga
gttgcagattcaatgcttgtgaatactgcattgatgttgatctatgtcaccaagttcttc
tggtgggaatctggatactggtgcactatggacattgctcatgatagagctggtttctac
atttgctggggatgcttggtatgggttccatcaatatacacctctcctggaatgtacctt
gtcaaccaccctgtgaatttgggtccccagctagcactctcaattctccttgctggaata
ttgtgcatatatataaactatgactgtgatcgtcagcgccaagaattccgtcggacaaat
gggaaatgctcaatatggggcaaagctccatctaagattgttgcttcctatcagactaca
aatggagaaacaaaaagcagtcttctcttgacttctggatggtggggcttgtctcgtcat
tttcactatgttccagagattctatctgcttttttctggacagttccagctctttttgat
catttcctgccgtacttctatgtgatctttctgaccatattgctgttcgaccgagctaaa
agggatgatgaccgatgctcatcaaagtatggcaagtattggaagatgtactgcaacaaa
gtaccgtgcagggttattcctggcatttactga

DBGET integrated database retrieval system