KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329624Help
Entry
4329624           CDS       T01015                                 

Definition
Os02g0550300
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4329624
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4329624
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4329624
  Exosomal proteins of colorectal cancer cells
   4329624
  Exosomal proteins of bladder cancer cells
   4329624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 425 aa AA seqDB search
MGKPTLPPVVVVVVLLLLVVVLPATTCGADAGGGGEAEEFQIPRDGRVLELDDGNFDAAV
RAAGLLFVDFYAPWCGHCKRLAPQLDEAAPVLAGLSTPIVVAKVNADKYKKLGSKYGVDG
FPTLMLFDHGTPTEYTGSRKADLLVENLKKLVAPDVSVLESDSAIKSFVEDAGMGFPLFL
GFGVDESLIVEYGAKYKNRAWFSVAKDFSEDMMVFYDFDKVPALVSVNPKYREQSIFYGP
FDDGAFLEDFIRNSLLPLVVPMNRETVKMLNDDGRKVVLMILQDDESDENSPRLIKVLRS
AASANRDLVFGYVGVNQWEEFTETFDVKSSELPTMIVWDKKEEYEIVEGSERLEEGDYGS
QISRFLEGYRAGRTIKKKVGDRSPTLLGVNAVYILVFLVAVLVLLMYFSGQGEEDQRPRQ
RAHED
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagccgacgctgccacccgtcgttgtcgtcgtcgtcctcctcctcctcgtcgtc
gtgctgccggcgacgacttgcggggcggacgcgggcggcggaggggaggcggaggagttc
cagatcccccgggacgggagggtgctggagctggacgacggcaacttcgacgcggcggtt
cgcgccgccggcctcctcttcgtcgacttctacgcgccatggtgcggccactgcaagcgc
ctcgcccctcagttagatgaagctgctccggtgctggctggattgagcacacccatcgta
gttgctaaggtgaatgccgacaaatacaaaaagctcggatcaaaatatggagtagatggg
ttccccactctgatgctctttgaccacggaaccccaacagagtacactggttcaaggaag
gccgatttgctcgttgagaaccttaagaagcttgttgcgcctgatgtttctgttctcgaa
tcggactcagcgatcaaaagcttcgttgaggatgctggcatgggttttccattgtttctc
gggtttggggtggatgaatccttgattgttgagtatggagcgaagtacaagaacagggcc
tggttttctgtagcaaaggatttctctgaagatatgatggtcttttatgatttcgacaag
gtccctgcattggtttctgttaacccaaagtatcgtgagcagagcattttctatggccct
tttgatgatggagccttcttggaagattttatacggaattcccttctgcctttagttgtg
cccatgaacagagagactgtcaagatgttgaatgatgatgggaggaaagtagttcttatg
attttacaggatgatgaatccgatgaaaattccccacggctgataaaagtattgaggtct
gcagccagtgcaaaccgtgatctagtgtttggttatgtaggagtcaaccagtgggaggaa
ttcactgagacttttgatgttaagagctcagagctgccaacgatgatagtctgggacaaa
aaagaggagtatgaaatagttgagggttcagaaaggcttgaagaaggtgactatgggtcc
cagattagccgtttccttgagggatacagggcaggaagaacaataaagaagaaagtgggc
gatcgatccccgaccctgcttggtgtgaatgcggtgtacattctcgtctttctggttgct
gttcttgttcttctcatgtatttctctgggcaaggcgaggaagatcaacgaccaagacaa
cgagcccatgaagattga

DBGET integrated database retrieval system