KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329652Help
Entry
4329652           CDS       T01015                                 

Definition
Os02g0554900
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4329652
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4329652
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4329652
  Exosomal proteins of colorectal cancer cells
   4329652
  Exosomal proteins of bladder cancer cells
   4329652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 545 aa AA seqDB search
MWPRAPATPPPPPWPSKPSAASRSALRRLDLDDGRRQGTEGEENHAPLLCSPAMASSTAF
AAAFALLLLASSAAAEGEAVLTLDAGNFTEVVGAHDFIVVEFYAPWCGHCNQLAPEYEAA
AAALRSHDPPVVLAKVDASADLNRGLAGEHGVQGYPTIRILRDRGARSHNYAGPRDAAGI
VAYLKRQAGPASVEIAASASPPAADSIANDGVVVVGVFPELSGSEFESFMAVAEKMRADY
DFRHTTDAGVLPRGDRTVRGPLVRLFKPFDELFVDSQDFDRDALEKFIESSGFPTVVTFD
TSPANQKYLLKYFDNAGTKAMLFLSFSDDRAEEFRTQFHEAANQYSANNISFLIGDVTAS
QGAFQYFGLKESEVPLVFILASKSKYIKPTVEPDQILPYLKEFTEGTLAPHVKSEPIPEV
NDQPVKTVVADNLREVVFNSGKNVLLEFYAPWCGHCQKLAPILEEVAVSLKDDEDVVIAK
MDGTANDVPSDFAVEGYPSMYFYSSGGNLLPYDGRTAEEIIDFITKNKGSRPGEATTTES
VKDEL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtggccacgagccccggccacgccgccgccgccgccatggccatcaaaacctagtgcc
gcctcgcgcagcgcgctgcgtcgtttggatctcgacgacggccggcgccaaggcacggag
ggagaagaaaaccacgcgcctcttctgtgttctccggcgatggcgagctccacggcattt
gcagcggcatttgcgctgctgctgctagcgtcgtcggcggcggcggagggggaggcggtg
ctgacgctggacgccggcaacttcacggaggtggtgggggcgcacgacttcatcgtcgtc
gagttctacgccccatggtgtggccactgcaaccagcttgctccggagtacgaggcggcc
gccgccgccctgcgctcgcacgacccgccggtcgtcctcgccaaggtcgacgccagcgcc
gacctgaaccggggcctcgccggcgagcacggcgtgcagggctaccccaccatcaggatc
ctccgggaccgcggcgccaggtcgcacaactacgccgggccccgggacgccgccggcatc
gtcgcctacctcaagaggcaggccggcccggcctccgtcgagatcgctgcctccgcctcg
ccgccagcggccgactccatcgccaacgacggcgtggtcgtcgtcggagttttccccgaa
cttagcggcagcgagttcgagagtttcatggcggtggcggagaagatgagggccgactac
gatttccggcacacgacggacgccggcgtcctcccacggggtgatcggacggtgaggggg
cctctcgtccgcctcttcaagcccttcgacgagctcttcgttgactcgcaggattttgat
agagatgcgttggagaagtttatcgagtcttctggtttccctacagtggttacctttgac
actagtccggcaaaccagaaataccttctgaaatacttcgacaatgccggcaccaaagcg
atgcttttcctgagcttcagtgatgacagagcagaggaattcagaactcagttccatgaa
gctgcaaatcaatacagcgcaaacaacataagctttctgattggtgatgtcactgcctct
cagggtgctttccagtattttgggcttaaagagagtgaagtgcccctcgttttcatacta
gcatcgaagtcgaagtatatcaaaccaactgtggagcctgatcagatcttgccctacctg
aaggaatttacagaaggaacattggcaccccatgttaaatcagaacccattccggaggtt
aacgatcagcctgttaagaccgttgttgctgacaatcttcgagaggtggttttcaactcc
ggcaaaaacgttctgctcgagttctatgctccatggtgtggacattgtcagaagctggcc
ccgatcttggaagaggttgcagtttcattgaaagatgatgaagacgtcgtcatagcaaag
atggatggtactgccaacgatgtaccgtcagatttcgcggtggaggggtacccaagcatg
tacttctactcgtctggggggaacctcctgccctacgacgggaggacagccgaggagatc
atcgatttcatcaccaagaacaagggctccaggcctggggaagcaaccacgactgaatct
gtcaaggatgaactgtga

DBGET integrated database retrieval system