KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329652Help
Entry
4329652           CDS       T01015                                 

Definition
Os02g0554900
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:osa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 545 aa AA seqDB search
MWPRAPATPPPPPWPSKPSAASRSALRRLDLDDGRRQGTEGEENHAPLLCSPAMASSTAF
AAAFALLLLASSAAAEGEAVLTLDAGNFTEVVGAHDFIVVEFYAPWCGHCNQLAPEYEAA
AAALRSHDPPVVLAKVDASADLNRGLAGEHGVQGYPTIRILRDRGARSHNYAGPRDAAGI
VAYLKRQAGPASVEIAASASPPAADSIANDGVVVVGVFPELSGSEFESFMAVAEKMRADY
DFRHTTDAGVLPRGDRTVRGPLVRLFKPFDELFVDSQDFDRDALEKFIESSGFPTVVTFD
TSPANQKYLLKYFDNAGTKAMLFLSFSDDRAEEFRTQFHEAANQYSANNISFLIGDVTAS
QGAFQYFGLKESEVPLVFILASKSKYIKPTVEPDQILPYLKEFTEGTLAPHVKSEPIPEV
NDQPVKTVVADNLREVVFNSGKNVLLEFYAPWCGHCQKLAPILEEVAVSLKDDEDVVIAK
MDGTANDVPSDFAVEGYPSMYFYSSGGNLLPYDGRTAEEIIDFITKNKGSRPGEATTTES
VKDEL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtggccacgagccccggccacgccgccgccgccgccatggccatcaaaacctagtgcc
gcctcgcgcagcgcgctgcgtcgtttggatctcgacgacggccggcgccaaggcacggag
ggagaagaaaaccacgcgcctcttctgtgttctccggcgatggcgagctccacggcattt
gcagcggcatttgcgctgctgctgctagcgtcgtcggcggcggcggagggggaggcggtg
ctgacgctggacgccggcaacttcacggaggtggtgggggcgcacgacttcatcgtcgtc
gagttctacgccccatggtgtggccactgcaaccagcttgctccggagtacgaggcggcc
gccgccgccctgcgctcgcacgacccgccggtcgtcctcgccaaggtcgacgccagcgcc
gacctgaaccggggcctcgccggcgagcacggcgtgcagggctaccccaccatcaggatc
ctccgggaccgcggcgccaggtcgcacaactacgccgggccccgggacgccgccggcatc
gtcgcctacctcaagaggcaggccggcccggcctccgtcgagatcgctgcctccgcctcg
ccgccagcggccgactccatcgccaacgacggcgtggtcgtcgtcggagttttccccgaa
cttagcggcagcgagttcgagagtttcatggcggtggcggagaagatgagggccgactac
gatttccggcacacgacggacgccggcgtcctcccacggggtgatcggacggtgaggggg
cctctcgtccgcctcttcaagcccttcgacgagctcttcgttgactcgcaggattttgat
agagatgcgttggagaagtttatcgagtcttctggtttccctacagtggttacctttgac
actagtccggcaaaccagaaataccttctgaaatacttcgacaatgccggcaccaaagcg
atgcttttcctgagcttcagtgatgacagagcagaggaattcagaactcagttccatgaa
gctgcaaatcaatacagcgcaaacaacataagctttctgattggtgatgtcactgcctct
cagggtgctttccagtattttgggcttaaagagagtgaagtgcccctcgttttcatacta
gcatcgaagtcgaagtatatcaaaccaactgtggagcctgatcagatcttgccctacctg
aaggaatttacagaaggaacattggcaccccatgttaaatcagaacccattccggaggtt
aacgatcagcctgttaagaccgttgttgctgacaatcttcgagaggtggttttcaactcc
ggcaaaaacgttctgctcgagttctatgctccatggtgtggacattgtcagaagctggcc
ccgatcttggaagaggttgcagtttcattgaaagatgatgaagacgtcgtcatagcaaag
atggatggtactgccaacgatgtaccgtcagatttcgcggtggaggggtacccaagcatg
tacttctactcgtctggggggaacctcctgccctacgacgggaggacagccgaggagatc
atcgatttcatcaccaagaacaagggctccaggcctggggaagcaaccacgactgaatct
gtcaaggatgaactgtga

DBGET integrated database retrieval system