KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329652Help
Entry
4329652           CDS       T01015                                 

Definition
(RefSeq) protein disulfide isomerase-like 1-3
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4329652
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4329652
Chaperones and folding catalysts [BR:osa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   4329652
Membrane trafficking [BR:osa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    4329652
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4329652
  Exosomal proteins of colorectal cancer cells
   4329652
  Exosomal proteins of bladder cancer cells
   4329652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 OST3_OST6 Thioredoxin_8 Thioredoxin_2 AhpC-TSA Redoxin TraF
Motif
Other DBs
NCBI-GeneID: 4329652
NCBI-ProteinID: XP_015626051
UniProt: Q69ST6
Position
2
AA seq 545 aa AA seqDB search
MWPRAPATPPPPPWPSKPSAASRSALRRLDLDDGRRQGTEGEENHAPLLCSPAMASSTAF
AAAFALLLLASSAAAEGEAVLTLDAGNFTEVVGAHDFIVVEFYAPWCGHCNQLAPEYEAA
AAALRSHDPPVVLAKVDASADLNRGLAGEHGVQGYPTIRILRDRGARSHNYAGPRDAAGI
VAYLKRQAGPASVEIAASASPPAADSIANDGVVVVGVFPELSGSEFESFMAVAEKMRADY
DFRHTTDAGVLPRGDRTVRGPLVRLFKPFDELFVDSQDFDRDALEKFIESSGFPTVVTFD
TSPANQKYLLKYFDNAGTKAMLFLSFSDDRAEEFRTQFHEAANQYSANNISFLIGDVTAS
QGAFQYFGLKESEVPLVFILASKSKYIKPTVEPDQILPYLKEFTEGTLAPHVKSEPIPEV
NDQPVKTVVADNLREVVFNSGKNVLLEFYAPWCGHCQKLAPILEEVAVSLKDDEDVVIAK
MDGTANDVPSDFAVEGYPSMYFYSSGGNLLPYDGRTAEEIIDFITKNKGSRPGEATTTES
VKDEL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtggccacgagccccggccacgccgccgccgccgccatggccatcaaaacctagtgcc
gcctcgcgcagcgcgctgcgtcgtttggatctcgacgacggccggcgccaaggcacggag
ggagaagaaaaccacgcgcctcttctgtgttctccggcgatggcgagctccacggcattt
gcagcggcatttgcgctgctgctgctagcgtcgtcggcggcggcggagggggaggcggtg
ctgacgctggacgccggcaacttcacggaggtggtgggggcgcacgacttcatcgtcgtc
gagttctacgccccatggtgtggccactgcaaccagcttgctccggagtacgaggcggcc
gccgccgccctgcgctcgcacgacccgccggtcgtcctcgccaaggtcgacgccagcgcc
gacctgaaccggggcctcgccggcgagcacggcgtgcagggctaccccaccatcaggatc
ctccgggaccgcggcgccaggtcgcacaactacgccgggccccgggacgccgccggcatc
gtcgcctacctcaagaggcaggccggcccggcctccgtcgagatcgctgcctccgcctcg
ccgccagcggccgactccatcgccaacgacggcgtggtcgtcgtcggagttttccccgaa
cttagcggcagcgagttcgagagtttcatggcggtggcggagaagatgagggccgactac
gatttccggcacacgacggacgccggcgtcctcccacggggtgatcggacggtgaggggg
cctctcgtccgcctcttcaagcccttcgacgagctcttcgttgactcgcaggattttgat
agagatgcgttggagaagtttatcgagtcttctggtttccctacagtggttacctttgac
actagtccggcaaaccagaaataccttctgaaatacttcgacaatgccggcaccaaagcg
atgcttttcctgagcttcagtgatgacagagcagaggaattcagaactcagttccatgaa
gctgcaaatcaatacagcgcaaacaacataagctttctgattggtgatgtcactgcctct
cagggtgctttccagtattttgggcttaaagagagtgaagtgcccctcgttttcatacta
gcatcgaagtcgaagtatatcaaaccaactgtggagcctgatcagatcttgccctacctg
aaggaatttacagaaggaacattggcaccccatgttaaatcagaacccattccggaggtt
aacgatcagcctgttaagaccgttgttgctgacaatcttcgagaggtggttttcaactcc
ggcaaaaacgttctgctcgagttctatgctccatggtgtggacattgtcagaagctggcc
ccgatcttggaagaggttgcagtttcattgaaagatgatgaagacgtcgtcatagcaaag
atggatggtactgccaacgatgtaccgtcagatttcgcggtggaggggtacccaagcatg
tacttctactcgtctggggggaacctcctgccctacgacgggaggacagccgaggagatc
atcgatttcatcaccaagaacaagggctccaggcctggggaagcaaccacgactgaatct
gtcaaggatgaactgtga

DBGET integrated database retrieval system