KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329652Help
Entry
4329652           CDS       T01015                                 

Gene name
OsPDIL1-3, PDIL1-3
Definition
(RefSeq) protein disulfide isomerase-like 1-3
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4329652 (OsPDIL1-3)
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4329652 (OsPDIL1-3)
Chaperones and folding catalysts [BR:osa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   4329652 (OsPDIL1-3)
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4329652 (OsPDIL1-3)
  Exosomal proteins of colorectal cancer cells
   4329652 (OsPDIL1-3)
  Exosomal proteins of bladder cancer cells
   4329652 (OsPDIL1-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 545 aa AA seqDB search
MWPRAPATPPPPPWPSKPSAASRSALRRLDLDDGRRQGTEGEENHAPLLCSPAMASSTAF
AAAFALLLLASSAAAEGEAVLTLDAGNFTEVVGAHDFIVVEFYAPWCGHCNQLAPEYEAA
AAALRSHDPPVVLAKVDASADLNRGLAGEHGVQGYPTIRILRDRGARSHNYAGPRDAAGI
VAYLKRQAGPASVEIAASASPPAADSIANDGVVVVGVFPELSGSEFESFMAVAEKMRADY
DFRHTTDAGVLPRGDRTVRGPLVRLFKPFDELFVDSQDFDRDALEKFIESSGFPTVVTFD
TSPANQKYLLKYFDNAGTKAMLFLSFSDDRAEEFRTQFHEAANQYSANNISFLIGDVTAS
QGAFQYFGLKESEVPLVFILASKSKYIKPTVEPDQILPYLKEFTEGTLAPHVKSEPIPEV
NDQPVKTVVADNLREVVFNSGKNVLLEFYAPWCGHCQKLAPILEEVAVSLKDDEDVVIAK
MDGTANDVPSDFAVEGYPSMYFYSSGGNLLPYDGRTAEEIIDFITKNKGSRPGEATTTES
VKDEL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtggccacgagccccggccacgccgccgccgccgccatggccatcaaaacctagtgcc
gcctcgcgcagcgcgctgcgtcgtttggatctcgacgacggccggcgccaaggcacggag
ggagaagaaaaccacgcgcctcttctgtgttctccggcgatggcgagctccacggcattt
gcagcggcatttgcgctgctgctgctagcgtcgtcggcggcggcggagggggaggcggtg
ctgacgctggacgccggcaacttcacggaggtggtgggggcgcacgacttcatcgtcgtc
gagttctacgccccatggtgtggccactgcaaccagcttgctccggagtacgaggcggcc
gccgccgccctgcgctcgcacgacccgccggtcgtcctcgccaaggtcgacgccagcgcc
gacctgaaccggggcctcgccggcgagcacggcgtgcagggctaccccaccatcaggatc
ctccgggaccgcggcgccaggtcgcacaactacgccgggccccgggacgccgccggcatc
gtcgcctacctcaagaggcaggccggcccggcctccgtcgagatcgctgcctccgcctcg
ccgccagcggccgactccatcgccaacgacggcgtggtcgtcgtcggagttttccccgaa
cttagcggcagcgagttcgagagtttcatggcggtggcggagaagatgagggccgactac
gatttccggcacacgacggacgccggcgtcctcccacggggtgatcggacggtgaggggg
cctctcgtccgcctcttcaagcccttcgacgagctcttcgttgactcgcaggattttgat
agagatgcgttggagaagtttatcgagtcttctggtttccctacagtggttacctttgac
actagtccggcaaaccagaaataccttctgaaatacttcgacaatgccggcaccaaagcg
atgcttttcctgagcttcagtgatgacagagcagaggaattcagaactcagttccatgaa
gctgcaaatcaatacagcgcaaacaacataagctttctgattggtgatgtcactgcctct
cagggtgctttccagtattttgggcttaaagagagtgaagtgcccctcgttttcatacta
gcatcgaagtcgaagtatatcaaaccaactgtggagcctgatcagatcttgccctacctg
aaggaatttacagaaggaacattggcaccccatgttaaatcagaacccattccggaggtt
aacgatcagcctgttaagaccgttgttgctgacaatcttcgagaggtggttttcaactcc
ggcaaaaacgttctgctcgagttctatgctccatggtgtggacattgtcagaagctggcc
ccgatcttggaagaggttgcagtttcattgaaagatgatgaagacgtcgtcatagcaaag
atggatggtactgccaacgatgtaccgtcagatttcgcggtggaggggtacccaagcatg
tacttctactcgtctggggggaacctcctgccctacgacgggaggacagccgaggagatc
atcgatttcatcaccaagaacaagggctccaggcctggggaagcaaccacgactgaatct
gtcaaggatgaactgtga

DBGET integrated database retrieval system