KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329740Help
Entry
4329740           CDS       T01015                                 

Definition
Os02g0573400
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 415 aa AA seqDB search
MARTARLLAAEDPPPPPAAAAERPRPAAAGSGLRSLSSAASGLWDRLSVLGAGVSKLEKA
LGDHFPEGARYFGLENFGNTCYCNSVLQALYHCIPFREQLLEYYATYKNTEDSEDNLLTC
LADLFSQITLAKKRTGVLAPKRFVQRVRKQNELFRSYMHQDAHEFWNFLVNDIIDILEED
CRTANSSPETTPEEVSNGAANALANGARERPLVTLVHRTFQGILTNETKCLMCDTITAKD
ETFFDLSIDVEQNSSLTSCLKSFFSTEILNGEDKFFCDKCSSLQEAHKRMKIKKAPHVLV
IHLKRFKYVEQLSRHKKLSYRVVYPLELKLGSMSEDADCEYSLFAVVVHVGSSPNHGHYV
SQIKSHGNWLSFDDDTVQISEESTLQTFYGSSREHCGGNTDHGYILFYERLGGKS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggacggcgcggctgctcgcggcggaggacccgccgccgccgccggcggcggcc
gcggagaggccccggccggcggcggcggggtcggggctccggtcgctctccagcgccgcg
tccgggctgtgggaccgcctctcggtcctcggcgcgggcgtctccaagctcgagaaggcc
ctcggcgaccacttccccgagggcgcgcgctacttcggcctcgagaacttcggcaacacc
tgctactgcaacagcgtcctgcaggcactttatcattgcatcccttttcgggagcagttg
ctggaatattatgcaacttacaaaaacacagaagactccgaggacaatttgttgacttgt
ctggctgatcttttttcacagataactctagcgaagaaaaggactggtgttcttgcacca
aaacgttttgttcaaagagtgaggaaacagaatgaattgttcagaagttatatgcaccag
gatgcccatgagttctggaatttcttagtgaatgatattattgatattcttgaagaagat
tgtagaactgcaaatagttctcctgagactactcctgaagaggtctcaaatggggcagcc
aatgctttagcaaatggagccagagaaaggccattagttacattggtgcacaggactttt
cagggtattttgaccaatgaaaccaaatgcctaatgtgtgatactatcacagcaaaagat
gagacgttttttgatttgagcattgacgtggaacagaatagttcgctcacaagctgcctg
aagagcttcttttccactgagattttaaatggcgaggataagttcttttgtgacaaatgc
agcagtttgcaagaagcacacaagagaatgaagataaagaaggcgccacacgtattggtg
atccacctgaagcgcttcaagtacgttgagcagcttagccggcacaagaaactgtcgtac
cgagtggtatatcccctggagctgaagctgggcagcatgtctgaagacgctgactgcgag
tactccctctttgcggttgtagtccatgttgggagcagccccaaccatggacactacgta
agccaaattaaaagccatggtaactggctttctttcgacgatgacaccgtccagatcagc
gaggaatccaccctgcaaacattctatggctcttctcgggagcattgtggtggcaacaca
gatcatggctatatcttgttctatgagcgccttggtgggaagagctag

DBGET integrated database retrieval system