KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329956Help
Entry
4329956           CDS       T01015                                 

Definition
Os02g0611300
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:osa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 263 aa AA seqDB search
MSCSKNCHCSDMCTNKPFRKDKKIKAVKTKRCGWGAISLEPLEKGDFIIEYVGEVINDAT
CEQRLWDMKRRGDKNFYMCEISKDFTIDATFKGNTSRFLNHSCDPNCKLEKWQVDGETRV
GVFASRSIQVGEHLTYDYRFVHFGEKVKCYCGAQNCQGYLGNQIKNPTQRALAIAALENE
WLESLKIQQDTSASRHKPMTHLLPWTNCIEVPFNLRSKRKIHRICWGCKRRRSAVAVTSP
TSIQASVTEAAAAAAAASLPALP
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagttgttccaagaattgccactgctcagatatgtgtacgaacaagccattccgcaag
gataaaaaaataaaagctgtcaagacaaaacgttgtggatggggtgctatttcattggag
ccattggaaaaaggtgattttataattgagtatgttggtgaagtcatcaatgatgcaaca
tgtgaacaaaggctttgggacatgaaacggcgaggtgataaaaatttctacatgtgtgaa
atcagcaaagattttacaatagatgcaacatttaaaggaaacacatcacgttttctgaac
cacagttgtgatcccaactgtaaattagaaaaatggcaagttgatggtgagacaagagtt
ggtgttttcgcctctcgttccatccaagttggagaacacttaacttatgactacaggttt
gtgcatttcggggagaaggttaaatgctattgcggggcacaaaattgtcaaggttacctg
ggcaaccaaataaagaatcctacgcagcgtgctctcgcaattgcagcattggagaacgag
tggcttgaatctttgaagatacaacaggacacctctgcttcaagacacaaaccgatgaca
catttgttaccttggaccaactgtatagaggtaccatttaacttgagaagcaaacggaaa
atacaccggatatgctggggatgcaaaaggaggagatcagccgttgccgttacatctcca
acaagcatacaagcgtcagttactgaagctgctgctgctgctgctgctgcatccctgccc
gctttgccatga

DBGET integrated database retrieval system