KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330187Help
Entry
4330187           CDS       T01015                                 

Gene name
OJ1003_B06.7
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase isozyme L3
  KO
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4330187 (OJ1003_B06.7)
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   4330187 (OJ1003_B06.7)
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    4330187 (OJ1003_B06.7)
  UBL-specific proteases (ULPs)
   4330187 (OJ1003_B06.7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 233 aa AA seqDB search
MGKRWIPLEANPDVMNQFMWGLGVAEGEAQFCDVYGLDDELLAMVPQPVLAVLFLYPLTS
LDDDEEESGAAATSTAGDKDLSKRVYFTKQTVGNACGTVGVIHAIGNAASKLKLVEGSYF
DRFYKQTVDMDPVQRAAFLEEDDEMEDAHSVAASAGDTDANVEVNEHFVCFSCVDGELYE
LDGRKSQPICHGPSSPDTLLQDAAKVIKARIASNPDSMNFNVMALSKVVGFRS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcggtggatccctctcgaggccaaccccgacgtcatgaaccagttcatgtgg
gggctgggagtcgccgagggggaggcgcagttctgcgacgtctacggcctcgacgacgag
ctgctcgccatggtgccccagcccgtgctcgccgtcctcttcctctacccgctcacttcc
ctggacgacgacgaggaggaatcaggcgctgctgccacttccacggctggggacaaggat
ttgagcaagagggtatactttacaaagcagactgttggcaacgcatgcggaacagttggt
gttatccatgcaatagggaatgctgcatccaaactcaagctggttgagggatcctatttt
gatagattttataaacaaactgttgatatggatccagtccagcgtgctgcctttcttgag
gaggatgatgagatggaggatgctcattccgttgctgcttcggctggcgacactgatgct
aatgttgaggtgaacgagcactttgtatgtttctcttgtgttgatggtgaactttatgag
cttgatggacgaaaatcgcaaccaatatgtcatggcccttcatcaccagatactttgtta
caggatgctgcaaaagtcatcaaagccagaattgcgtccaaccctgactcaatgaacttc
aacgtcatggctctttcgaaagttgtgggttttagatcatag

DBGET integrated database retrieval system