KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330187Help
Entry
4330187           CDS       T01015                                 

Definition
Os02g0654500
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 229 aa AA seqDB search
MGKRWIPLEANPDVMNQFMWGLGVAEGEAQFCDVYGLDDELLAMVPQPVLAVLFLYPLTS
LDDDEEESGAAATSTAGDKDLSKRVYFTKQTVGNACGTVGVIHAIGNAASKLKLVEGSYF
DRFYKQTVDMDPVQRAAFLEEDDEMEDAHSVAASAGDTDANVEVNEHFVCFSCVDGELYE
LDGRKSQPICHGPSSPDTLLQDAAKVIKARIASNPDSMNFNVMALSKVV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcggtggatccctctcgaggccaaccccgacgtcatgaaccagttcatgtgg
gggctgggagtcgccgagggggaggcgcagttctgcgacgtctacggcctcgacgacgag
ctgctcgccatggtgccccagcccgtgctcgccgtcctcttcctctacccgctcacttcc
ctggacgacgacgaggaggaatcaggcgctgctgccacttccacggctggggacaaggat
ttgagcaagagggtatactttacaaagcagactgttggcaacgcatgcggaacagttggt
gttatccatgcaatagggaatgctgcatccaaactcaagctggttgagggatcctatttt
gatagattttataaacaaactgttgatatggatccagtccagcgtgctgcctttcttgag
gaggatgatgagatggaggatgctcattccgttgctgcttcggctggcgacactgatgct
aatgttgaggtgaacgagcactttgtatgtttctcttgtgttgatggtgaactttatgag
cttgatggacgaaaatcgcaaccaatatgtcatggcccttcatcaccagatactttgtta
caggatgctgcaaaagtcatcaaagccagaattgcgtccaaccctgactcaatgaacttc
aacgtcatggctctttcgaaagttgtgtaa

DBGET integrated database retrieval system