KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330235Help
Entry
4330235           CDS       T01015                                 

Definition
Os02g0664000
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:osa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:osa00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 238 aa AA seqDB search
MPSRTAPFISRLRLLRTAAALSPFSSSAPPRHSPRILRAIPVGAPHPPRVSAAVSPLVRP
VAAGFALFSMATAASSAASVHDFTVKDASGKDVDLSTFKGKVLLIVNVASQCGLTNSNYT
ELSQLYEKYKDQGFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDNT
APIYKFLKSSKGGLFGDNIKWNFSKFLVDKEGRVVERYAPTTSPLSMEKDIKKLLGSS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcgcaccgccccgttcatctctcgcctccggctcctccgaaccgccgccgcc
ctctccccgttctcgtcctccgcgccgccgcggcacagcccccgcatcctccgcgctatc
cctgtcggtgcgcctcacccgccgcgcgtctccgcagccgtctcgccgctggtccgtccg
gtcgccgccgggttcgcgctgttcagcatggccaccgccgcctcctccgccgcatccgtc
cacgacttcaccgtcaaggatgcaagtggcaaagatgtggacctgagcaccttcaagggg
aaagtcctccttatcgtcaatgttgcatctcagtgtggcttgaccaattccaactacacg
gagctgagccagttgtatgagaagtacaaggaccagggttttgagatccttgctttccca
tgcaaccagtttggtggacaggaacctggcactaatgaggagattgtccaatttgcttgc
acccgcttcaaggccgagtatccaatttttgataaggttgatgttaatggtgacaacact
gcacccatctacaagtttctgaagtccagcaaaggtggtcttttcggtgacaatatcaaa
tggaacttctccaagttcttggtcgacaaagaggggcgtgttgtggagcgctatgcgcca
actacttctccactcagcatggagaaggacatcaagaagctgcttggaagttcttaa

DBGET integrated database retrieval system