KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330388Help
Entry
4330388           CDS       T01015                                 

Definition
Os02g0693400
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4330388
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   4330388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 257 aa AA seqDB search
MADQNGAAAVSEAEAAPVQVETGAESGDAESEQYQPFFSMCQPIRSVSYSNSWDMVCAPT
IKSNEHNSNLDSMDDKYMLSAPWPENEQPQSENDMDLLDGDTNMQSEPLSTEQPSSNDEI
DIWDGKTKQDSSSLLDSKLCNSGSGAEPCNMEGQQFSLSFSRNTQSQLVGSGLGNMGNTC
FLNSILQCVTHTVPLFLRLRSTDHCAPCSYDKDGFCSFCALKEHIDESIRRSGSVIRPVR
FRDNLRSILCSRFFLAV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccagaacggcgccgcggccgtgagcgaagcggaggccgcccctgttcaggtt
gaaactggtgctgaaagtggggatgctgaaagtgagcagtaccaaccatttttctccatg
tgccagccgattcgctctgttagctattcaaattcctgggatatggtttgtgcccccaca
attaagagtaacgaacacaatagcaacttggattcgatggatgataaatacatgctgagt
gcaccttggcctgaaaatgagcagccccagtctgagaatgacatggatttgttagatggg
gatacaaatatgcagtctgaacccctcagcacagagcagcctagctccaatgatgaaata
gatatctgggatgggaaaactaagcaagactcatcatcccttcttgacagcaagctgtgc
aactccggcagcggcgctgaaccttgcaacatggagggccaacaattttctttgtccttt
tcccgcaacactcaatctcaattggtgggatctggtcttggcaatatggggaacacatgc
ttcctaaactcaattcttcagtgtgtcacccatacagtcccactttttctcaggcttcgt
tccactgatcactgtgctccatgctcatatgataaagatggtttctgttcattctgtgct
cttaaagaacatattgatgaatcaatccgaaggtctggatctgttataaggccagtgagg
ttcagagataatttaaggagtatcctttgctctcgatttttccttgcagtttaa

DBGET integrated database retrieval system