KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330957Help
Entry
4330957           CDS       T01015                                 

Gene name
OJ1316_E06.24
Definition
(RefSeq) mitogen-activated protein kinase kinase 5
  KO
K13413  
mitogen-activated protein kinase kinase 4/5 [EC:2.7.12.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
MAPK signaling pathway - plant
Plant hormone signal transduction
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    4330957 (OJ1316_E06.24)
   04075 Plant hormone signal transduction
    4330957 (OJ1316_E06.24)
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    4330957 (OJ1316_E06.24)
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     4330957 (OJ1316_E06.24)
Protein kinases [BR:osa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   4330957 (OJ1316_E06.24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 369 aa AA seqDB search
MRPGGPPSLRAGLQQQQQQQPGTPGRSRRRPDLTLPLPQRDLTSLAVPLPLPLPPSSAPS
STSSSGSSSLGGVPTPPNSVGSAPPAPPPLSELERVRRIGSGAGGTVWMVRHRPTGRPYA
LKVLYGNHDDAVRRQITREIAILRTAEHPAVVRCHGMYEQAGELQILLEYMDGGSLEGRR
IASEAFLADVARQVLSGIAYLHRRHIVHRDIKPSNLLIDSGRRVKIADFGVGRILNQTMD
PCNSSVGTIAYMSPERINTDLNDGAYDGYAGDIWSFGLSILEFYMGRFPLGENLGKQGDW
AALMCAICYSDSPAPPPNASPEFKSFISCCLQKNPARRPSAAQLLQHRFVAGPQQQQQPQ
PQPLAPPPS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccgggcgggccgccgagcttgcgggcggggctgcagcagcagcagcagcagcag
ccggggacgccggggaggtcgcggcgccggccggatctcacgctgccgctgccgcagcgg
gacctcacgtcgctcgcggtgccgctgccgctgccgctgccgccgtcgtcggcgccgtcg
tcgacgtcgtcgtccgggtcgtcctcgctcggcggcgtgcccaccccgccgaattcggtc
ggctccgcgccgccggccccgccgccgctgtcggagctggagcgcgtccgccgcatcggg
agcggcgcgggcgggacggtgtggatggtgcggcaccgccccacggggcggccgtacgcg
ctcaaggtgctctacgggaaccacgacgacgccgtgcggcggcagatcacgcgcgagatc
gcgatcctccgcaccgccgagcacccggccgtcgtgcggtgccacggcatgtacgagcag
gccggcgagctccagatcctgctcgagtacatggacgggggatccctcgagggccgccgc
atcgcctccgaggccttcctcgccgacgtcgcgcgccaggtgctctccgggatcgcctac
ctccaccgccgccacatcgtccaccgcgacatcaagccatccaacctcctcatcgactcc
ggccgccgcgtcaagatcgccgacttcggcgtcggccgcatcctcaaccagaccatggac
ccctgcaactcctccgtcgggaccatcgcctacatgagccccgagcgcatcaacaccgac
ctcaacgacggcgcctacgacggctacgccggcgacatctggagcttcggcctgagcatt
ctcgagttctacatgggcaggttccccctcggggagaatctcggcaagcagggagactgg
gccgccctcatgtgcgcgatttgctactccgactcgccggcgccgccgcccaacgcctcg
ccggagttcaagagcttcatcagctgctgcctccagaagaacccggcgcggcggccatcg
gcggcgcagcttctccaacatcggttcgtcgccgggccacagcagcagcagcagccgcag
ccgcagcccctcgcaccgcctccgtcatga

DBGET integrated database retrieval system