KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330957Help
Entry
4330957           CDS       T01015                                 

Definition
Os02g0787300
Orthology
K13413  
mitogen-activated protein kinase kinase 4/5, plant [EC:2.7.12.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    4330957
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     4330957
Protein kinases [BR:osa01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   4330957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 404 aa AA seqDB search
LPPIGLVLSTPRAHQKTHTPTRANQPAAPRLAAVAMRPGGPPSLRAGLQQQQQQQPGTPG
RSRRRPDLTLPLPQRDLTSLAVPLPLPLPPSSAPSSTSSSGSSSLGGVPTPPNSVGSAPP
APPPLSELERVRRIGSGAGGTVWMVRHRPTGRPYALKVLYGNHDDAVRRQITREIAILRT
AEHPAVVRCHGMYEQAGELQILLEYMDGGSLEGRRIASEAFLADVARQVLSGIAYLHRRH
IVHRDIKPSNLLIDSGRRVKIADFGVGRILNQTMDPCNSSVGTIAYMSPERINTDLNDGA
YDGYAGDIWSFGLSILEFYMGRFPLGENLGKQGDWAALMCAICYSDSPAPPPNASPEFKS
FISCCLQKNPARRPSAAQLLQHRFVAGPQQQQQPQPQPLAPPPS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ctgcccccgatcggcctcgtcctctccacgccgcgagcccaccagaaaacgcacacgccg
acgcgagccaatcaacccgccgcgccgcgcctcgccgccgtcgcgatgcgaccgggcggg
ccgccgagcttgcgggcggggctgcagcagcagcagcagcagcagccggggacgccgggg
aggtcgcggcgccggccggatctcacgctgccgctgccgcagcgggacctcacgtcgctc
gcggtgccgctgccgctgccgctgccgccgtcgtcggcgccgtcgtcgacgtcgtcgtcc
gggtcgtcctcgctcggcggcgtgcccaccccgccgaattcggtcggctccgcgccgccg
gccccgccgccgctgtcggagctggagcgcgtccgccgcatcgggagcggcgcgggcggg
acggtgtggatggtgcggcaccgccccacggggcggccgtacgcgctcaaggtgctctac
gggaaccacgacgacgccgtgcggcggcagatcacgcgcgagatcgcgatcctccgcacc
gccgagcacccggccgtcgtgcggtgccacggcatgtacgagcaggccggcgagctccag
atcctgctcgagtacatggacgggggatccctcgagggccgccgcatcgcctccgaggcc
ttcctcgccgacgtcgcgcgccaggtgctctccgggatcgcctacctccaccgccgccac
atcgtccaccgcgacatcaagccatccaacctcctcatcgactccggccgccgcgtcaag
atcgccgacttcggcgtcggccgcatcctcaaccagaccatggacccctgcaactcctcc
gtcgggaccatcgcctacatgagccccgagcgcatcaacaccgacctcaacgacggcgcc
tacgacggctacgccggcgacatctggagcttcggcctgagcattctcgagttctacatg
ggcaggttccccctcggggagaatctcggcaagcagggagactgggccgccctcatgtgc
gcgatttgctactccgactcgccggcgccgccgcccaacgcctcgccggagttcaagagc
ttcatcagctgctgcctccagaagaacccggcgcggcggccatcggcggcgcagcttctc
caacatcggttcgtcgccgggccacagcagcagcagcagccgcagccgcagcccctcgca
ccgcctccgtcatga

DBGET integrated database retrieval system