KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331043Help
Entry
4331043           CDS       T01015                                 

Definition
(RefSeq) calcineurin subunit B
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 175 aa AA seqDB search
MGNASSMLTQYDIEEVQEHCNYLFSQQEIVSLYERFCQLDRSAKGFISEDEFLSIPEFSL
NPLSKRLLRMVDGLNFKDFVSFLSTFSAKASVQQKIELIFKVYDIDGKGKVTFKDLVEVL
RDQTGSFMTEEQRERVITNVLEEAGYTRDCTLSLEDFTRIIDHPGLKMEVEVPID
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgcgtcgtcgatgctcacccagtacgacatcgaggaggtgcaggagcactgc
aactacctcttctcgcagcaggagatcgtgtcgctgtacgagcgattctgccagctggat
cggagcgccaaggggttcatctccgaggacgagttcctctccatcccggagttctccctc
aacccgctctccaagaggttgctgcgtatggttgatgggctgaacttcaaggattttgtt
tccttcctctctaccttcagtgcaaaggccagcgttcagcaaaagattgagttgatattc
aaggtgtatgacattgatggcaaggggaaggtaaccttcaaagacctggtagaggttttg
cgggaccaaacagggtcattcatgacagaggaacaaagagagcgagtaataacaaatgta
ctggaagaagctggatacacaagggattgcacgctttctttggaagattttaccaggatt
atagatcatcctggcctaaagatggaggtggaagtgcctattgactag

DBGET integrated database retrieval system