KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331166Help
Entry
4331166           CDS       T01015                                 

Gene name
OJ1202_E07.27, P0474F11.8
Definition
(RefSeq) serine/threonine-protein phosphatase PP1
  KO
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    4331166 (OJ1202_E07.27)
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     4331166 (OJ1202_E07.27)
Protein phosphatases and associated proteins [BR:osa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     4331166 (OJ1202_E07.27)
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     4331166 (OJ1202_E07.27)
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     4331166 (OJ1202_E07.27)
Spliceosome [BR:osa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    4331166 (OJ1202_E07.27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 316 aa AA seqDB search
MDPVLLDDIIRRLIEVKNLKPGKNAQLSESEIKQLCATSKEIFLNQPNLLELEAPIKICG
DVHGQYSDLLRLFDYGGYPPQSNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRG
NHECASVNRIYGFYDECKRRFSVKLWKTFTDCFNCLPVAALIDEKILCMHGGLSPELNKL
DQILNLNRPTDVPDTGLLCDLLWSDPSNDAQGWAMNDRGVSYTFGPDKVSEFLEKHDLDL
ICRAHQVVEDGYEFFANRQLVTIFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPARKML
GGSTNSKSGFKSLRGW
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggatccggtgttgctggacgacatcatccggaggcttatcgaggtgaagaatctgaag
ccggggaagaacgcgcagctttcggagtcggagattaagcagctctgcgcaacctccaag
gagatcttcctgaatcagcccaacctgctcgagctcgaggcccccatcaaaatctgcggt
gatgttcatggacagtattctgatctcctgaggctgtttgattatggtgggtatccacct
cagtccaactatctcttcttgggcgattatgtggaccggggaaagcaaagccttgagacg
atatgccttcttttggcttataagatcaagtaccctgaaaacttcttcctactcagaggc
aaccatgaatgtgcatcggtcaaccgcatctatggattttatgacgagtgcaagcgcaga
ttcagtgtaaaactctggaagacttttactgactgttttaactgcttaccagtggcagca
ttgatagatgaaaagattctttgtatgcacggaggtctttctccagagttgaataagctg
gatcaaatactcaacctcaaccgccccacggatgtgcctgatactgggttactttgtgat
ctcctttggtccgatccatccaatgacgcacaagggtgggctatgaatgatcgaggtgtc
tcatatacattcgggccagacaaagtgtctgaatttcttgagaagcatgatttagacctc
atctgtcgagcccatcaggttgtcgaagatgggtacgagttctttgctaaccgccaactt
gtaacaatattctcggcccctaattactgtggagaatttgataatgctggtgccatgatg
agtgtagatgatacactgatgtgctcttttcaaatactaaaaccagcgaggaaaatgttg
ggtggttccacgaattccaaatccggcttcaagtcactgagagggtggtga

DBGET integrated database retrieval system