KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331185Help
Entry
4331185           CDS       T01015                                 

Definition
Os02g0822200
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4331185
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   4331185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 331 aa AA seqDB search
MSWCTIESDPGVFTELIQEMQVKGVQVEELYSLDVDSISELRPVYGLIFLFKWMAGEKDE
RPVVKDPNPNLFFASQVIPNACATQAILSILMNRPEIDIGPELSNLKEFTGAFAPDMKGL
AINNSDSIRTAHNSFARPEPFVSDEQRAAGKDDEVYHFISYLPFEGVLYELDGLKEGPIS
LGQCSGGPDDLDWLRMVQPVIQKRIERYSQSEIRFNLMAIIKNRKDVYTAELKELEKRRD
QLLQEMNESSAAESLNSELAEVTSAIETVSEKIIMEEEKFKKWRTENIRRKHNYIPFLFN
FLKMLAEKKQLKPLVEKAKQQKASSTSTSAR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggtgcacgattgagtctgatcccggtgttttcaccgaattgatccaggagatg
caagtaaaaggtgttcaggtggaagaactttactctcttgatgtggactctattagtgaa
ctgcggccagtttatgggctaatttttctcttcaagtggatggctggggaaaaggatgaa
cggcctgtcgtcaaagatccaaacccaaaccttttctttgctagccaggtcatccctaat
gcatgtgctactcaagctattctgtcaatcctcatgaatcgcccagaaattgacataggt
ccagaactatccaacttgaaggaattcacaggagcttttgcacctgacatgaagggcctt
gctattaacaacagtgattctattcgcacagcccataacagttttgccaggcctgagcca
tttgtctcagatgagcaaagagctgcgggtaaggatgatgaagtgtaccatttcataagc
tatttaccttttgaaggagtcctctatgagcttgatggattgaaggaaggacccataagc
cttgggcagtgttctggtgggcctgatgatcttgattggctaaggatggtgcagccagtt
atacaaaaaagaattgaacgctattcccagagcgagattaggtttaaccttatggccatc
attaagaataggaaggatgtatatactgctgagctgaaggagctggagaagagaagggac
cagcttttgcaggagatgaatgagtcctcagcagcagagtccttaaacagcgaacttgca
gaggtgacatcagccattgagactgtcagcgagaagattatcatggaagaagagaagttc
aagaagtggaggacggagaacatcaggaggaagcacaactacattccctttctattcaac
tttctcaagatgctggcggaaaagaagcagctaaagccattggttgagaaggccaaacaa
cagaaggcttccagcacaagcacgagtgcaagatga

DBGET integrated database retrieval system