KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331236Help
Entry
4331236           CDS       T01015                                 

Definition
Os02g0829100
Orthology
K10739  
replication factor A2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:osa03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:osa03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:osa03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:osa03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 279 aa AA seqDB search
MMSFSQPDAFSPSQFTSSQNAAADSTTPSKSRGASSTMPLTVKQISEAQQSGITGEKGAP
FVVDGVETANVRLVGLVSGKTERNTDVSFTIDDGTGRLDFIRWVNDGADSAETAAVQNGM
YVSVIGSLKGLQERKRATAFAIRPVTDYNEVTLHFIQCVRMHLENTKSQIGSPAKTYSAM
GSSSSNGFSEMTTPTSVKSNPAPVLSVTNGSKTDLNTEVLNVFREPANVESEHGVHIDEI
VKRFRLPEAKIKVAIDYLADIGHIYSTIDESHYKSAFNE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccttcagccagcccgacgccttctcgccgtcgcagttcacctcctcccagaat
gccgccgccgactctaccaccccttccaagagccggggcgcatcgagcaccatgccgctc
accgtgaagcagatctctgaagcgcagcaatctggcatcaccggggagaagggcgctccc
ttcgtcgtcgacggcgtcgagacagccaacgttaggcttgtgggattggtcagtggcaag
acggagcggaacaccgatgtgtccttcacgatcgacgatggcaccggccgcctcgatttc
atcagatgggtcaatgatggtgctgattctgctgaaaccgctgctgttcagaatggaatg
tatgtttctgtcattggtagcctcaaggggcttcaggagaggaagcgtgctactgctttc
gctatcaggcctgtaactgattataatgaggtcacactgcatttcattcagtgcgtgcga
atgcatttagagaacaccaaatcacagattggtagccctgcaaaaacatattctgccatg
ggatcctcatcttccaatggcttcagtgaaatgaccactccgacctctgtgaaatccaac
ccggcaccagtgctcagtgtaacaaatggatcaaaaactgatttgaacacagaagtgctg
aatgttttccgcgaaccagcaaacgtcgagagcgagcatggtgtgcacattgatgaaatc
gtgaagcgcttcaggctaccggaggccaagatcaaggtagctattgattacctcgctgac
attgggcacatatactcaacaatcgacgagtctcactacaagtcagcgttcaatgaataa

DBGET integrated database retrieval system