KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331236Help
Entry
4331236           CDS       T01015                                 

Gene name
OJ1124_D06.4, OsJ_08977, OsRPA32, OsRPA32-1, OsRPA32A, RPA2A, RPA32A
Definition
(RefSeq) replication protein A 32 kDa subunit A
  KO
K10739  
replication factor A2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    4331236 (OJ1124_D06.4)
   03420 Nucleotide excision repair
    4331236 (OJ1124_D06.4)
   03430 Mismatch repair
    4331236 (OJ1124_D06.4)
   03440 Homologous recombination
    4331236 (OJ1124_D06.4)
DNA replication proteins [BR:osa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4331236 (OJ1124_D06.4)
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4331236 (OJ1124_D06.4)
   MMR (mismatch exicision repair)
     4331236 (OJ1124_D06.4)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4331236 (OJ1124_D06.4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 279 aa AA seqDB search
MMSFSQPDAFSPSQFTSSQNAAADSTTPSKSRGASSTMPLTVKQISEAQQSGITGEKGAP
FVVDGVETANVRLVGLVSGKTERNTDVSFTIDDGTGRLDFIRWVNDGADSAETAAVQNGM
YVSVIGSLKGLQERKRATAFAIRPVTDYNEVTLHFIQCVRMHLENTKSQIGSPAKTYSAM
GSSSSNGFSEMTTPTSVKSNPAPVLSVTNGSKTDLNTEVLNVFREPANVESEHGVHIDEI
VKRFRLPEAKIKVAIDYLADIGHIYSTIDESHYKSAFNE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccttcagccagcccgacgccttctcgccgtcgcagttcacctcctcccagaat
gccgccgccgactctaccaccccttccaagagccggggcgcatcgagcaccatgccgctc
accgtgaagcagatctctgaagcgcagcaatctggcatcaccggggagaagggcgctccc
ttcgtcgtcgacggcgtcgagacagccaacgttaggcttgtgggattggtcagtggcaag
acggagcggaacaccgatgtgtccttcacgatcgacgatggcaccggccgcctcgatttc
atcagatgggtcaatgatggtgctgattctgctgaaaccgctgctgttcagaatggaatg
tatgtttctgtcattggtagcctcaaggggcttcaggagaggaagcgtgctactgctttc
gctatcaggcctgtaactgattataatgaggtcacactgcatttcattcagtgcgtgcga
atgcatttagagaacaccaaatcacagattggtagccctgcaaaaacatattctgccatg
ggatcctcatcttccaatggcttcagtgaaatgaccactccgacctctgtgaaatccaac
ccggcaccagtgctcagtgtaacaaatggatcaaaaactgatttgaacacagaagtgctg
aatgttttccgcgaaccagcaaacgtcgagagcgagcatggtgtgcacattgatgaaatc
gtgaagcgcttcaggctaccggaggccaagatcaaggtagctattgattacctcgctgac
attgggcacatatactcaacaatcgacgagtctcactacaagtcagcgttcaatgaataa

DBGET integrated database retrieval system