KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331707Help
Entry
4331707           CDS       T01015                                 

Definition
Os03g0161800
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:osa00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 198 aa AA seqDB search
MENQFQDGKEEVIEAWYMDDSEEDQRLPHHREPKEFIPLSKLSELGILSWRLNADDWEND
ENLKKIREARGYSYMDICDVCPEKLPNYEAKLKNFFEEHLHTDEEIRYCLEGSGYFDVRD
QNDQWIRVAVKKGGMIVLPAGMYHRFTLDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARK
EYVEKIINRGGTQAVEAR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccagttccaggatggcaaggaggaggtcatcgaagcttggtacatggatgac
agtgaagaggaccagaggcttcctcatcatcgtgagcccaaagaattcattcctcttagc
aaactttcagagttaggaatattaagctggcgcctgaatgctgatgactgggagaatgat
gagaacctcaagaaaatccgtgaggccaggggatactcttacatggatatttgtgatgtg
tgtccagaaaagctgccaaactatgaggctaagctgaaaaatttctttgaagaacacttg
catactgatgaagagatacgctattgtcttgagggaagtggatacttcgatgtcagggac
caaaatgatcagtggatccgtgtagcagtgaagaaagggggcatgattgttttgcctgcg
ggaatgtatcaccgcttcacattggacagtgacaactacatcaaggcaatgcggctcttt
gtgggagagcctgtctggacgccgtacaaccgtccccatgaccatctgccagctagaaag
gagtatgtcgaaaaaattatcaacaggggtggaactcaagctgtcgaagctcgttaa

DBGET integrated database retrieval system