KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331869Help
Entry
4331869           CDS       T01015                                 

Definition
Os03g0186100
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    4331869
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     4331869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 302 aa AA seqDB search
MALSSSSHLLPFSRPPATFPRARHAGGGRGRAGATGRFIACSSPPPPDVVVTRERGKNAK
LIAALEKHNVQSLELPLIKHVEGPDTDRLSAVLRDEKFDWITITSPEAAAVFLEGWKAAG
NPKVRIAVVGAGTERVFDEVIQYNDGSLEVAFSPSKAMGKFLASELPRTTETTCKVLYPA
SAKAGHEIQNGLSNRGFEVTRLNTYTTVSVQDVDPLILKPALSAPVVAVASPSALRAWLN
LASQVDNWGNAIACIGETTASAAKKFGLKSIYYPTTPGLDGWVESILEALRAHGQSKEAP
GC
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccttgtcctcctcttcgcacctcctccccttctcccggcctcccgcgaccttccca
cgagcacgccacgccggcggcgggaggggccgagccggcgccacggggaggttcatagcg
tgctcctcgccccctcctcccgacgtcgtggtcacccgcgagcgcgggaagaacgccaag
ctcatcgccgcgctggaaaaacataatgtacaaagtcttgagcttcctcttattaaacat
gttgaagggccagatacagataggctttctgctgtcctgcgcgatgaaaagtttgactgg
atcactataacatctcctgaggcagctgctgtgttccttgagggatggaaggctgctgga
aatcctaaggtacgaatagcggttgttggagcaggtactgaaagagtttttgacgaagta
attcaatacaatgatggatcccttgaggttgcattttctccttctaaagctatgggtaaa
tttttggcctcagagcttccaaggaccactgaaactacttgtaaagtgttatatcctgca
tctgcaaaggctggccatgaaatccagaatgggctatcaaatcgaggatttgaggtgaca
agactgaacacatatacaactgtatctgtacaggatgtcgatccgctaatattaaagcct
gctctttcagctccagttgttgcagtagcttctccttctgctctccgagcttggctaaat
cttgcttcacaagttgacaactggggcaacgccattgcctgcataggcgagacgactgcc
tcagcagctaagaaatttggcctgaagagcatatattatcctaccaccccgggacttgac
gggtgggttgaaagcatccttgaagcgctcagagcccatgggcaatcgaaagaggcccca
gggtgttga

DBGET integrated database retrieval system