KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331901Help
Entry
4331901           CDS       T01015                                 

Definition
Os03g0190800
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 366 aa AA seqDB search
MGAASSRLEKALGEQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFREQLLEYYANNKS
TGDVEDNMLTCLADLFSQISNQKKKTGVIAPKRFIQRLKKQNEIFRSYMHQDAHEFLNFL
LNELVDILEKESKVVAEPCENSSLKKNSNGPINVQLNGTKKEPVPTLVHKCFQGILTNET
RCLRCETVTDRDETFFDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQK
RMKIKKPPNILVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLINTVDNSDLEYSLFAVLV
HVGSGPNHGHYISLVKSHNHWLFFDDENVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE
SLAEKS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcggcgagctctaggctggagaaggcgctgggcgagcagttccccgagggcgag
cgctacttcggcctcgagaacttcggcaacacctgctactgcaacagcgtcctgcaggca
ctttacttttgtgttcctttccgtgagcaattactggagtactatgcaaataataaaagc
accggagatgtcgaagacaatatgttaacgtgcttagctgacctgttctctcagatcagc
aaccagaagaagaaaacaggtgttatcgctcctaagcgtttcatacaacgactgaagaaa
caaaatgagatttttcgcagctatatgcaccaggatgcacatgaatttctgaattttttg
cttaatgagctagttgacatcctagagaaagaatctaaagttgttgcagaaccttgtgaa
aattcctctttgaaaaagaattcaaacgggcctataaatgttcaactcaatggtactaaa
aaagaaccagttcctactttggtccacaaatgcttccagggcatattgactaatgaaaca
agatgtctaagatgtgagactgtgactgatagagatgaaacgttttttgacctaagtctg
gatattgaacagaatagttcaattaccagctgtcttaaaaacttcagctcgactgagact
ctgaatgctgaggataagttcttctgtgacaaatgctgcagtttgcaagaagcacagaaa
agaatgaagataaagaaaccaccaaacattcttgtaattcatctcaagcgcttcaagtat
attgaacagcttggtcgctacaaaaagctatcatatcgagttgttttccctctggagctt
aaacttatcaatactgttgacaactcagacttggaatattccctttttgctgtgctagtt
catgttggaagtggaccaaatcatggccactatatcagcttagtgaagagccacaaccac
tggttgttcttcgacgacgagaatgttgagatgactgatgagtccatggtacagacattc
tttggctcagcacaagagttcagtggtaacactgataacggctacatactcttctatgaa
agccttgctgaaaaaagttga

DBGET integrated database retrieval system