KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331918Help
Entry
4331918           CDS       T01015                                 

Definition
Os03g0192800
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     4331918
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   4331918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 311 aa AA seqDB search
MSRPNTRNKSKRPRADDCESPSAVFKKIHSTGAITKGDIKQLYMVWKPVCHGCHGNSKDS
PNCFCGLIPAANGVRKSGLWQRTNEIIRALGPNPSTDLRDSTETPAGLTNLGATCYANSI
LQCLYMNTSFRLGIFSLEPDILKMHPVLDQLARLFAQLHSSKMAFIDSAPFIKTLELDNG
VQQDSHEFLTLFLSLLEGSLSHSKVPGARTIVQHLFRGSVSHVTRCSSCGRDSEASSKME
DFYELELNIKGLNNLEQSLDDYLSTEALDGENQYFCESCQKRVDATRCIKLRSLPPVVNF
QLKRYVFLPKV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggccaaacacacgaaataagagcaagaggccgcgggctgatgactgcgagagc
ccgtctgctgttttcaagaagatacattccactggagcaatcacaaaaggcgatattaaa
caactttatatggtgtggaaacctgtttgtcatggttgccatgggaactccaaggactca
cccaattgtttctgcgggttgatccctgctgctaatggggtgaggaaatctggcctgtgg
cagagaacaaacgagatcattcgcgcccttggtcctaacccgtcgacggatcttcgtgac
tccactgagacgcctgctggattgactaacctgggcgctacctgttatgcaaacagcata
ctgcagtgcctttacatgaacacctccttccgcttgggcattttctctctagagcccgac
atcttgaagatgcaccctgtgctggatcagcttgctcggttattcgctcagctacactcc
agcaaaatggctttcattgattcggcaccttttataaaaaccttggaattagataatggt
gtccagcaggacagccatgaattcctcacattatttttgtctttgctcgagggttcacta
agtcattccaaggttccaggggctagaaccattgtgcagcatttgttccgtggaagtgtg
tcccatgttactcggtgctcatcatgtggaagggattccgaagcatcttcaaagatggaa
gacttttacgaactggagcttaacattaaaggtttaaataatctagaacaaagtttggat
gactatttgagtactgaggcactggatggagagaaccagtacttctgtgagtcatgtcag
aaaagggtagatgccactcgttgcataaaacttcgctcacttcctcctgttgttaatttt
cagctgaaacgctatgtattcctcccaaaggtgtag

DBGET integrated database retrieval system