KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332327Help
Entry
4332327           CDS       T01015                                 

Definition
Os03g0262400
Orthology
K03259  
translation initiation factor 4E
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:osa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 227 aa AA seqDB search
MEPAAEKREAEQEELQQQHDEPAVPSADDDEAEAEENERRNRELKAGFHPLRRRFVLWYT
RRTPGARSQSYEDNIKKIVDFSTVESFWVCYCHLTRPVSLPSPTDLHLFKEGIRPLWEDP
ANRSGGKWIIRFKKTVSGRFWEDLVLVLVGDQLDYSDDVCGVVLSVRFNEDILSVWNRNA
SDHQAVMTLRDSIKRHLKLPHSYLMEYKPHDASLRDNSSYRNTWLRG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggagccggcggcggagaagagggaggccgagcaggaggagctgcagcagcagcacgac
gagcccgccgtcccttccgccgacgacgacgaggctgaggcggaggagaacgagcgccgc
aaccgcgagctcaaggccggcttccatccccttaggcgtagattcgtgctatggtacacg
cgccggactcctggggcgaggtcgcagtcctacgaggacaacatcaagaagatcgtcgac
ttcagcactgttgagtcgttctgggtttgctactgccacctcacgcggccggttagcctg
ccgagccccaccgacctgcatcttttcaaggagggcatccggcccctctgggaggatccc
gcaaataggagcggtggcaagtggatcataaggtttaagaagaccgtctctggtcgtttc
tgggaggatttggtgttggtgctagtgggtgatcaacttgattatagtgatgatgtttgt
ggcgttgtactcagtgttcgtttcaatgaggacattctaagtgtctggaaccgtaatgca
tctgaccaccaggctgtgatgacattaagagattcaattaagaggcatctgaagctgcca
cacagctatctgatggagtacaaaccacatgatgcttcactgcgggataactcatcttac
aggaacacgtggttgagaggataa

DBGET integrated database retrieval system