KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332346Help
Entry
4332346           CDS       T01015                                 

Definition
Os03g0265200
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4332346
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C86
   4332346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 202 aa AA seqDB search
MESGPKSEAKQDEEGSSAMGGGGGSSRSSKVYHERQRLQFCLLHALNNLMQEKESFTRAE
LDGIAGNLVQIDPNKEHWTPMSLIFKPHHNVFTGNYDVNVLITALEARKKKVIWHDHRKG
ASSIDLDADALFGLMINVPVRRFRGLWTGRHWVAIRSINGTWFNLDSDFSAPKEFQDKEK
LIAFLDSILSQGGEVMIVLQDE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaatcggggcccaaatcggaagcaaaacaagacgaggagggatcgagtgcgatgggc
ggcggcggcggcagcagcagaagcagcaaggtgtatcacgagaggcaacggctgcagttc
tgtctcctccacgccctcaacaaccttatgcaggaaaaggaatctttcacccgagctgag
ttagatgggattgctggaaatctcgtccagattgatccaaataaggagcactggactcct
atgtcattgatttttaagccccaccacaacgtattcaccgggaactatgatgtaaatgta
ctcatcacagcattagaagctagaaagaagaaggtaatctggcatgatcatcggaaaggg
gcttcttcaatcgatctggatgcagatgcattgtttggtctgatgatcaatgtacccgtc
aggaggttcagagggctttggactggccggcattgggtggcaattcgaagcattaatggc
acttggtttaatttggatagtgatttttctgcacccaaggagtttcaggacaaagaaaaa
cttattgcatttctagacagcattctcagtcaaggtggagaagtcatgatagtgctgcaa
gatgaataa

DBGET integrated database retrieval system