KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332497Help
Entry
4332497           CDS       T01015                                 

Definition
Os03g0289300
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:osa00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:osa04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 594 aa AA seqDB search
MGTYKCCIFFTRRFALSDASTPGDVRMLFTRHAGGAPYMGIDELRRYLAASGEAHVDADT
AERIIDRVLQERSRTPRFGKPSLTIDDFQYFLFSEDLNPPICHSKEVHHDMNAPLSHYFI
YTGHNSYLTGNQLSSDCSDIPIIKALQIGVRVIELDMWPNSSKDDVDILHGRTLTAPVSL
IKCLKSIKEYAFVASPYPVIITLEDHLTSDLQAKVAKMVLEVFGDTLYYPESKHLQEFPS
PEALRGRVILSTKPPKEYLESKGGTMKDRDIEPQFSKGQNEEAVWGTEVPDIQDEMQTAD
KQHENDILYTQRDVEEDDEKKMCQHHPLEYKHLITIKAGKPKGAVVDALKGDPDKVRRLS
LSEQELAKVAAHHGRNIVSFTHKNLLRIYPKGTRFNSSNYNPFLGWVHGAQMVAFNMQGY
GRSLWLMHGFYKANGGCGYVKKPDFMMQTCPDGNVFDPKADLPVKKTLKVKVYMGEGWQS
DFKQTYFDTYSPPDFYAKVGIAGVPSDSVMQKTKAVEDSWVPVWEEEFVFPLTVPEIALL
RVEVHEYDVSEDDFGGQTALPVSELRPGIRTVPLFDHKGLKFKSVKLLMRFEFV
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggggacgtacaagtgctgcatcttcttcacccgcaggttcgcgctgagcgacgcgtcc
acgccgggcgacgtgcgcatgctgttcacccgccacgccggcggcgcgccctacatgggc
atcgacgagctccggcgctacctcgccgccagcggggaggcccacgtcgacgccgacacg
gcggagcggatcatcgaccgggtcctgcaggagcgcagccgcaccccgcgcttcgggaag
ccgtcgctcaccatcgacgatttccagtacttcctcttctccgaggacctcaacccgccc
atctgccattccaaggaagtccatcacgacatgaatgcaccattatcgcactacttcata
tacactggacacaactcgtatctgacgggcaatcaacttagcagtgactgcagtgatatt
cccatcattaaggcactgcaaataggcgtccgtgtaattgaactggacatgtggccaaat
tcttctaaagatgatgttgatattctccatggaaggacactgactgccccagtatcactt
atcaaatgcttgaaatccatcaaagaatatgcctttgttgcgtctccctaccctgttatt
ataacattagaagaccaccttacatctgatcttcaggcgaaagtagctaagatggttctt
gaagtatttggagataccctatattatcccgagtcaaaacatcttcaagaatttccttca
cccgaagcactgaggggacgtgtcatcctctcaacaaaacccccaaaggagtaccttgaa
tcaaaaggtggtactatgaaagacagagacattgagcctcagtttagcaaaggacaaaat
gaagaagctgtctggggaacagaagtcccagatattcaggatgagatgcaaaccgccgac
aagcagcatgagaatgatatactatacacccaaagagatgtggaagaagatgatgagaag
aaaatgtgccagcatcacccactagagtataaacaccttattactattaaggcaggaaag
ccaaagggtgctgtagttgatgccttaaagggtgatccagataaagttagacgcctcagt
ttgagtgagcaggaacttgcaaaagtggcagcgcatcatggtcgtaacatcgtgagcttt
acacataaaaatcttctgagaatatacccaaagggcactcgcttcaattcttcgaactat
aatccgtttcttggttgggtgcatggtgcacaaatggtggcatttaatatgcaggggtat
ggaagatctctttggctaatgcacggattctacaaggccaacggtggctgcggttatgtg
aagaagccagatttcatgatgcaaacttgtccagatggaaatgtttttgacccgaaagca
gatttacctgtgaagaaaacactcaaggtcaaagtatacatgggcgaaggttggcagagc
gacttcaagcagacatacttcgacacgtattcccctccagacttctacgcaaaggtgggc
attgccggggttccgtcggactcggtgatgcagaagacgaaagccgtggaggacagctgg
gttcccgtgtgggaggaggagttcgtgttcccgctgaccgtcccggagatcgcgctgctc
cgcgtggaggtgcacgagtacgacgtgagcgaggacgacttcggcgggcagacggcgctc
ccggtgtcggagctgcggccggggatccgcaccgtgccgctcttcgaccacaaggggctc
aagttcaagagcgtcaagctcctcatgcggttcgagttcgtctag

DBGET integrated database retrieval system