KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332497Help
Entry
4332497           CDS       T01015                                 

Definition
(RefSeq) phosphoinositide phospholipase C 6
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4332497
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    4332497
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    4332497
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     4332497
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    4332497
 Endocytosis
  Macropinocytosis
   Phospholipase C
    4332497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 598 aa AA seqDB search
MGTYKCCIFFTRRFALSDASTPGDVRMLFTRHAGGAPYMGIDELRRYLAASGEAHVDADT
AERIIDRVLQERSRTPRFGKPSLTIDDFQYFLFSEDLNPPICHSKEISCSQVHHDMNAPL
SHYFIYTGHNSYLTGNQLSSDCSDIPIIKALQIGVRVIELDMWPNSSKDDVDILHGRTLT
APVSLIKCLKSIKEYAFVASPYPVIITLEDHLTSDLQAKVAKMVLEVFGDTLYYPESKHL
QEFPSPEALRGRVILSTKPPKEYLESKGGTMKDRDIEPQFSKGQNEEAVWGTEVPDIQDE
MQTADKHENDILYTQRDVEEDDEKKMCQHHPLEYKHLITIKAGKPKGAVVDALKGDPDKV
RRLSLSEQELAKVAAHHGRNIVSFTHKNLLRIYPKGTRFNSSNYNPFLGWVHGAQMVAFN
MQGYGRSLWLMHGFYKANGGCGYVKKPDFMMQTCPDGNVFDPKADLPVKKTLKVKVYMGE
GWQSDFKQTYFDTYSPPDFYAKVGIAGVPSDSVMQKTKAVEDSWVPVWEEEFVFPLTVPE
IALLRVEVHEYDVSEDDFGGQTALPVSELRPGIRTVPLFDHKGLKFKSVKLLMRFEFV
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggggacgtacaagtgctgcatcttcttcacccgcaggttcgcgctgagcgacgcgtcc
acgccgggcgacgtgcgcatgctgttcacccgccacgccggcggcgcgccctacatgggc
atcgacgagctccggcgctacctcgccgccagcggggaggcccacgtcgacgccgacacg
gcggagcggatcatcgaccgggtcctgcaggagcgcagccgcaccccgcgcttcgggaag
ccgtcgctcaccatcgacgatttccagtacttcctcttctccgaggacctcaacccgccc
atctgccattccaaggaaatctcgtgctctcaggtccatcacgacatgaatgcaccatta
tcgcactacttcatatacactggacacaactcgtatctgacgggcaatcaacttagcagt
gactgcagtgatattcccatcattaaggcactgcaaataggcgtccgtgtaattgaactg
gacatgtggccaaattcttctaaagatgatgttgatattctccatggaaggacactgact
gccccagtatcacttatcaaatgcttgaaatccatcaaagaatatgcctttgttgcgtct
ccctaccctgttattataacattagaagaccaccttacatctgatcttcaggcgaaagta
gctaagatggttcttgaagtatttggagataccctatattatcccgagtcaaaacatctt
caagaatttccttcacccgaagcactgaggggacgtgtcatcctctcaacaaaaccccca
aaggagtaccttgaatcaaaaggtggtactatgaaagacagagacattgagcctcagttt
agcaaaggacaaaatgaagaagctgtctggggaacagaagtcccagatattcaggatgag
atgcaaaccgccgacaagcatgagaatgatatactatacacccaaagagatgtggaagaa
gatgatgagaagaaaatgtgccagcatcacccactagagtataaacaccttattactatt
aaggcaggaaagccaaagggtgctgtagttgatgccttaaagggtgatccagataaagtt
agacgcctcagtttgagtgagcaggaacttgcaaaagtggcagcgcatcatggtcgtaac
atcgtgagctttacacataaaaatcttctgagaatatacccaaagggcactcgcttcaat
tcttcgaactataatccgtttcttggttgggtgcatggtgcacaaatggtggcatttaat
atgcaggggtatggaagatctctttggctaatgcacggattctacaaggccaacggtggc
tgcggttatgtgaagaagccagatttcatgatgcaaacttgtccagatggaaatgttttt
gacccgaaagcagatttacctgtgaagaaaacactcaaggtcaaagtatacatgggcgaa
ggttggcagagcgacttcaagcagacatacttcgacacgtattcccctccagacttctac
gcaaaggtgggcattgccggggttccgtcggactcggtgatgcagaagacgaaagccgtg
gaggacagctgggttcccgtgtgggaggaggagttcgtgttcccgctgaccgtcccggag
atcgcgctgctccgcgtggaggtgcacgagtacgacgtgagcgaggacgacttcggcggg
cagacggcgctcccggtgtcggagctgcggccggggatccgcaccgtgccgctcttcgac
cacaaggggctcaagttcaagagcgtcaagctcctcatgcggttcgagttcgtctag

DBGET integrated database retrieval system