KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332612Help
Entry
4332612           CDS       T01015                                 

Definition
Os03g0307800
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     4332612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 895 aa AA seqDB search
MASSSSKASDSSSQRPKRPDQGPSGKDAAGLVALHGKLAQLKRQVQSTRLAAIKERVEAN
RKALQVHTCALFDVAAAAEVASRGAEGGNALSRGAAEGHRRFVGWDSASGPGERELVHVQ
EENLVAGTLVLSSSGGSGASHRTVVQLVKLPVVDKIPPYTTWIFLDKNQRMADDQSVGRR
RIYYDPIVNEALICSESDDDVPEPEEEKHVFTEGEDQLIWKATQDHGLSREVLNVLCQFV
DATPSEIEERSEVLFEKYEKQSQSSYKTDLQLFLDKTMDVALDSFDNLFCRRCLVFDCRL
HGCSQNLVFPSEKQPYGHELDENKRPCGDQCYLRRREVYQDTCNDDRNACTTYNMDSRSS
SLKVSATILSESEDSNRDEDNIKSTSIVETSRSKITNSEYADKSVTPPPGDASETENVSP
DMPLRTLGRRKISKHASKSNDHSPDKRQKIYSSPFPFAMSVLNKQSVPEIGETCPDSIES
AVDQLPSLDDPNKKISTKDMCAGSTTNTTENTLRDNNNNLFISNKEHSISHWSALERDLY
LKGIEIFGKNSCLIARNLLSGLKTCMEVASYMYNNGAAMAKRPLSGKSILGDFAEAEQGY
MEQDLVARTRICRRKGRARKLKYTWKSAGHPTVRKRIGDGKQWYTQYNPCGCQQMCGKDC
ACVENGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAASRECDPDVCRNCWVSCG
DGSLGEPLARGDGYQCGNMKLLLKQQQRILLGKSDVAGWGAFIKNPVNRNDYLGEYTGEL
ISHREADKRGKIYDRANSSFLFDLNEQYVLDAYRKGDKLKFANHSSNPNCYAKVMLVAGD
HRVGIYAKDRIEASEELFYDYRYGPDQAPAWARRPEGSKKDEASVSHHRAHKVAR
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcctcgtccaaggcctccgattcctcttcccaacgccccaagcggccggat
caagggccgtcgggcaaggacgcggccggcctcgtcgcgctgcacgggaagctggcgcag
ctgaagcgtcaggtccaatccacccgcctcgccgcgatcaaggagagggtggaggcgaac
aggaaggcgctgcaggtgcacacgtgcgctctgttcgacgtcgccgcggcggcggaggtg
gcgtcgcggggcgccgagggcggcaacgcgctgtcgcggggcgcggcggaggggcaccgc
aggttcgtggggtgggactcggcgagcgggccgggggagagggagttggtgcatgtgcag
gaggagaatctggtcgccgggacgctcgtgctctcgagctctggtggtagcggcgcctcg
cataggaccgtcgtgcagcttgtgaagctgcctgtggtcgacaagattccgccctacacc
acgtggatcttcctggacaaaaaccaaagaatggccgatgatcagtcagttggtaggagg
agaatttactacgacccaattgtcaatgaggctctgatctgcagtgaaagtgacgatgat
gttccagagccagaggaagagaaacatgttttcacagaaggagaagatcagctaatatgg
aaagctactcaagatcatgggttaagtcgagaggttttaaatgtcctctgccagtttgtt
gatgcaactccttcagaaattgaggaaagatcagaagttctttttgagaaatatgagaag
cagtctcaatcttcttacaagacagatttgcaactttttcttgacaagaccatggatgtg
gctttagattcttttgataatctcttctgtcggagatgtttggtttttgattgccgtctc
catgggtgctcccagaacttggtattccctagcgagaagcaaccatatggtcatgaactt
gatgaaaacaagagaccgtgtggcgatcagtgctaccttcgaaggagagaagtatatcaa
gatacgtgcaatgatgaccgaaatgcttgtacaacatataatatggattcaagatcttcc
tcactcaaagttagtgctaccatattgtctgaatcagaagattcaaacagagatgaagat
aacatcaaatccacttctattgttgaaaccagcagatcaaaaataactaattctgaatat
gctgacaaaagtgtgacaccacctcctggagatgcttctgaaactgaaaatgtgtcccct
gacatgcccctaagaactttaggcaggcgtaagatttcaaagcatgcctccaagtctaac
gatcattcacctgataaaaggcagaagatatatagctcaccgtttccttttgcaatgagt
gtactgaacaagcaatctgttccagaaattggtgagacatgtccagattccatagaatct
gcagttgatcaacttccaagtctggatgaccctaacaagaaaatttctaccaaagatatg
tgtgctggaagcacaactaacactactgaaaatacattacgagataataataataatttg
ttcatctccaacaaggagcactctatttctcattggagtgctttagagagagatttgtac
ttgaagggaattgagatatttgggaaaaacagttgtctcatagctagaaacctattgtct
ggcctgaagacctgcatggaagtggccagctacatgtacaacaatggtgcggcaatggca
aagagacctctatctggtaaatccattttaggtgactttgcagaggctgaacaaggttac
atggagcaagatttggtggcaaggacaagaatctgtcgtcgtaagggccgagctcgaaag
ctcaaatacacttggaagtctgcagggcatccaactgtaagaaaaagaatcggtgatgga
aagcaatggtacactcagtataacccatgtgggtgtcagcaaatgtgtggcaaagattgc
gcctgtgtggaaaatggaacttgttgcgagaagtactgcgggtgctcaaagagctgcaaa
aataggtttagaggatgtcattgcgcaaaaagtcaatgcagaagcagacagtgcccgtgt
tttgctgccagtcgtgaatgtgatccagatgtttgcagaaactgctgggtgagctgcgga
gatggctcactaggtgagccactggcaagaggtgatggctatcagtgtggaaacatgaaa
ctcctcttaaaacaacaacaacgtatattgcttggaaaatctgatgttgcgggttggggt
gcattcattaagaacccagtaaatagaaatgattaccttggtgaatacactggcgaattg
atttctcatagagaagcagataagcgtggcaaaatatatgatcgagcaaattcatcgttc
ctatttgatttaaatgagcagtatgtactggatgcttatcgcaagggggataaactgaag
tttgcaaatcactcgtcgaatcctaactgctatgcgaaggttatgttggtggctggcgat
catcgagttggtatctatgcaaaggaccgcattgaggctagcgaggaactcttttatgat
taccgctatggacctgaccaagccccagcttgggctaggagaccggaagggtcaaaaaag
gatgaagcatctgtctctcaccaccgagcgcacaaagttgctagatag

DBGET integrated database retrieval system