KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332674Help
Entry
4332674           CDS       T01015                                 

Definition
Os03g0320900
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    4332674
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     4332674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 285 aa AA seqDB search
MLLTRRFSSALARSPLLPRSLPPPRAVPATPPAPRPPPRRLMSSSSSGWHHSSRPPPPPP
SGADKDQLFRGLEAALGTTFSSEPLAPPPQPMILVISGPSGVGKDAVIQRLQEEREGMHF
VVTATSRAKRPGEVDGKDYYFVTKEEFLTMIERKELLEYALVYGEYKGIPKQQIRDYMAK
GYDIVLRVDIQGAATLREILGESAIFIFLVAESEEALVKRLIHRKTETSDMLLVRVATAR
EEVKRMNNFDYVVVNSEGNLEGAVKQVESIIDAEKAKVHKRTVNI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcacgcgaaggttctcctccgccctcgcgcgctccccccttctccccaggtcc
ctccctcctccgcgggccgtgcccgccacccctccggcgccccgcccgccgccgcgccgc
ctcatgtcctcctcctcctccggctggcaccactcctctcgcccgcccccgccgcccccc
tccggcgccgacaaggatcagctgttccgggggctggaggcggcgctcggcacgacgttc
agctcggagccgctcgcgccgccgccgcagccgatgatcctcgtcatcagcgggcccagc
ggcgtcggcaaggacgctgtcatccagaggctgcaagaagagagggaggggatgcatttc
gttgtcaccgcgacaagcagagcgaagcggcccggtgaagttgatgggaaggactattac
ttcgtcaccaaggaggagttcctcacgatgattgaaaggaaggagttgctcgagtacgca
cttgtctatggggagtataaggggatccccaagcagcagatccgtgattacatggcgaaa
ggttatgatattgtcttgagagtggacattcaaggagcagcaaccttgagagagattctt
ggcgaatcagcaattttcatctttttggttgcagagagtgaagaggcacttgtcaaaagg
ctaattcaccgcaaaacagaaacatcagatatgcttcttgtcagagttgcaacggccaga
gaagaggtgaaacgcatgaacaattttgattatgtagttgtcaattctgaagggaatctt
gagggggctgttaaacaggtggagtctatcattgatgctgagaaggctaaggtccacaaa
cgtacggttaatatctag

DBGET integrated database retrieval system