KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332690Help
Entry
4332690           CDS       T01015                                 

Gene name
CHLH
Definition
(RefSeq) magnesium-chelatase subunit ChlH, chloroplastic
  KO
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    4332690 (CHLH)
Enzymes [BR:osa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     4332690 (CHLH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1387 aa AA seqDB search
MSSLVSTPFTTATGVQKKLGAPVPLHSFLLSRRQPAAGAGRGRAAAAAIRCAVAGNGLFT
QTKPEVRRVVPPEGDASRRGVPRVKVVYVVLEAQYQSSVTAAVRELNADPRRAAGFEVVG
YLVEELRDEETYKTFCADLADANVFIGSLIFVEELALKVKDAVEKERDRMDAVLVFPSMP
EVMRLNKLGSFSMSQLGQSKSPFFQLFKRKKNSGGFADSMLKLVRTLPKVLKYLPSDKAQ
DARLYILSLQFWLGGSPDNLQNFLKMIAVSYVPALKGADIKYDDPVLFLDAGIWHPLAPT
MYDDVKEYLNWYGTRRDTNDKLKDPNAPVIGLVLQRSHIVTGDDGHYVAVIMELEAKGAK
VIPIFAGGLDFSGPTQRYLVDPITGKPFVNAVVSLTGFALVGGPARQDHPKAIAALQKLD
VPYIVALPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFAGRDPRTGKSHAL
HKRVEQLCTRAIRWAELKRKTKEEKKLAITVFSFPPDKGNVGTAAYLNVFNSIYSVLQDL
KKDGYNVEGLPDTAEALIEEVIHDKEAQFNSPNLNVAYRMNVREYQSLTSYASLLEENWG
KPPGNLNSDGENLLVYGKQYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYTFVE
KIFQADAVLHFGTHGSLEFMPGKQVGMSDACYPDSLIGNIPNIYYYAANNPSEATVAKRR
SYANTISYLTPPAENAGLYKGLKQLSELISSYQSLKDTGRGPQIVSSIISTAKQCNLDKD
VPLPEEGVELPPNERDLIVGKVYAKIMEIESRLLPCGLHVIGEPPSAIEAVATLVNIASL
DRPEDEIYSLPNILAQTVGRNIEDVYRGSDKGILADVELLRQITEASRGAITTFVERTTN
NKGQVVDVTNKLSTMLGFGLSEPWVQHLSKTKFIRADREKLRTLFTFLGECLKLIVADNE
LGSLKLALEGSYVEPGPGGDPIRNPKVLPTGKNIHALDPQAIPTTAALKSAKIIVDRLLE
RQKVDNGGKYPETIALVLWGTDNIKTYGESLAQVLWMIGVRPVADTFGRVNRVEPVSLEE
LGRPRIDVVINCSGVFRDLFINQMNLLDRAVKMVAELDEPEEMNYVRKHAQEQARELGVS
LREAATRVFSNASGSYSSNVNLAVENASWTDEKQLQDMYLSRKSFAFDCDAPGAGMREQR
KTFELALATADATFQNLDSSEISLTDVSHYFDSDPTKLVQGLRKDGRAPSSYIADTTTAN
AQVRTLSETVRLDARTKLLNPKWYEGMMKSGYEGVREIEKRLTNTVGWSATSGQVDNWVY
EEANATFIEDEAMRKRLMDTNPNSFRKLVQTFLEASGRGYWETSEENLEKLRELYSEVED
KIEGIDR
NT seq 4164 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctttagtgtcgacgccgttcacgacggcaaccggggtgcagaagaagctgggg
gcgcccgtgccgctccactcgttcttgctgagccggcggcagccagcggcgggcgcgggg
aggggacgcgcggcggcggcggcgatacggtgcgcggtggccgggaacgggctgttcacg
cagaccaagccggaggtgcggcgcgtggtgccgcccgagggcgacgcgtcgcggcgcggg
gtgccgcgggtgaaggtggtgtacgtcgtgctggaggcgcagtaccagtcgtcggtgacg
gcggcggtgcgggagctcaacgccgacccgcgccgcgcggcggggttcgaggtggtgggc
tacctcgtggaggagctccgggacgaggagacgtacaagaccttctgcgccgacctcgcc
gacgccaatgtgttcatcggctcgctcatcttcgtggaggagctcgcgctcaaggtgaag
gatgccgtcgagaaggagcgcgaccggatggacgccgtgctcgtcttcccgtcgatgccg
gaggtcatgcgcctcaacaagctcggctccttcagcatgtcccagctcggccagtccaag
agcccattcttccagctcttcaagcgcaagaagaactccggtggcttcgccgatagcatg
ctcaagctggtgcgcacgctgcccaaggtgctcaagtacttgccctccgacaaggcgcag
gacgcccggctgtacatcctcagcctccagttctggctcggaggctcgccggacaacctc
cagaatttcctcaagatgatcgccgtctcctacgtgccggcgctcaagggcgccgacatc
aagtacgacgaccccgtcctcttcctcgacgctggtatctggcacccgctggcgcccacc
atgtacgacgacgtcaaggagtacctcaactggtacggcacccgccgcgacaccaacgac
aagctcaaggaccccaacgcgccggtgatcggcctcgttttgcagaggagccacattgtc
accggagacgacggtcactacgtcgccgtgatcatggagctggaggccaagggtgccaag
gtcataccgatcttcgccggcgggctggacttctcgggacccacgcagcggtacctcgtc
gacccgatcaccggaaagccgttcgtgaacgcggtggtgtcgctcaccgggttcgcgctc
gtcggagggccagcgaggcaggaccatcccaaggcgatcgccgcgctgcagaagctcgac
gtgccgtacatcgtggcactgccgctcgtgttccagacgacagaggagtggctgaacagc
acattgggcctgcacccgattcaggtggcgctgcaggttgcgctcccggagcttgacggt
ggcatggagcccattgtgttcgccggccgtgaccccagaacagggaagtcacatgcgttg
cacaagagggtggagcagctctgcactagagcaatcagatgggcagagctgaagaggaaa
actaaggaggagaagaaactggcaatcactgttttcagcttcccaccagacaaaggcaat
gttggcacagcagcatacctgaatgttttcaactccatctactccgtcctccaagatctg
aagaaggatggctacaatgttgagggtcttccagacacagctgaggccctcatcgaggag
gttattcatgataaggaggcccaattcaatagccccaacctcaatgttgcttaccgcatg
aacgtgcgggagtaccagtcactcacttcctatgcctccttgctggaggagaactggggc
aagccacctgggaaccttaattctgatggtgaaaacctccttgtctatgggaaacagtac
ggcaatgtattcattggagttcagcccacttttggctatgaaggagatccgatgcggctt
ctgttctcaaaatctgctagccctcaccatggctttgcagcatactacacctttgttgag
aagatcttccaggctgatgctgttcttcactttggtacccatgggtctcttgagttcatg
ccagggaagcaggttgggatgagtgatgcatgctatcctgacagtctcattggcaacatc
cccaatatctactactatgcagcaaacaatccatcagaagcaactgttgccaagcgcaga
agctatgcaaacaccataagctacctgacaccaccagctgaaaatgctggtctctacaag
gggctcaagcagctttcagagctcatctcttcttaccaatctctcaaggacacaggacgt
ggtccgcagattgtgagctcaatcattagcactgcaaaacagtgtaatcttgacaaggat
gttcccttgcctgaggaaggtgtggagcttccaccaaatgagcgtgaccttattgttgga
aaggtgtatgccaagatcatggaaatagaatcacgcctcctaccatgcggtctgcatgtg
ataggtgagccaccaagtgccatcgaggctgtggccaccttggtgaacatagcttccctt
gatcgcccagaggatgaaatatactcactgcctaacatacttgctcagacagtgggcagg
aacattgaagatgtgtacagaggaagtgacaagggaatactggcggatgttgaactgttg
aggcagataacagaagcttcacgtggtgccatcactacctttgttgagaggactacaaac
aacaaagggcaagttgttgatgttacaaacaaacttagtaccatgcttggttttggttta
tcagaaccatgggtacaacacttgtccaagaccaagttcatcagagcagacagagagaaa
ttgagaaccttgtttactttcttgggagaatgcttgaagctaattgtggcagataatgag
ctgggaagcttgaaacttgccctcgagggaagctatgttgaacctggccctggtggtgat
ccaatccgtaacccgaaggttctcccgacagggaagaacatccatgctcttgaccctcag
gcaatcccaactacagctgccttgaagagcgccaaaattattgtagaccgtctgctggag
cggcaaaaggttgacaatggtggcaagtatcctgagacaattgcacttgtcttgtggggc
accgataacatcaagacctatggtgagtcattggcccaggtgctgtggatgattggtgtg
cgcccggttgctgacacctttggccgtgtcaaccgtgtggaacctgtcagccttgaggag
cttggacgtcccaggattgacgttgttatcaactgctcgggtgtcttcagagatcttttc
atcaaccagatgaatctactggaccgggcagtgaagatggttgccgaactggatgagcca
gaagagatgaactacgtgcgtaagcatgcacaagagcaggcacgggaacttggcgtttca
ttaagagaggcggcaacaagggtgttctcaaatgcatcaggctcttactcatcgaatgtg
aacttggcagtggagaatgcatcatggactgatgagaagcagctccaggacatgtacctg
agtcgcaagtcttttgcatttgattgtgatgctccaggggcaggcatgcgagagcaacgc
aagacatttgagcttgctctagcaacagcagatgccacattccagaacctagactcatca
gagatttcactaacagatgtgagccactactttgactcagacccgacaaagctggtgcaa
ggactgcgcaaggatgggcgggcaccttcctcatacatagcagatacaaccacagcaaat
gcacaggtgaggacattgtcagagacagtgcgccttgatgcaaggacaaagctactgaac
cctaagtggtacgaggggatgatgaaaagtggctacgagggagttagagagattgagaag
cggctgacaaatactgttggatggagtgcaacatctggacaggttgacaactgggtttat
gaggaggcaaatgccacatttattgaagatgaggctatgaggaagaggctcatggacacc
aaccccaattcattcaggaagctagttcagaccttcctagaagccagtggcagaggctac
tgggagacatcagaggaaaacttggaaaagctcagggagctctactctgaggttgaagac
aagattgaaggaattgaccggtaa

DBGET integrated database retrieval system