KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333259Help
Entry
4333259           CDS       T01015                                 

Definition
Os03g0563300
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    4333259
Enzymes [BR:osa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     4333259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 415 aa AA seqDB search
MASAFSPATAAPAASPALFSASTSRPLSLTAAAAAVSARIPSRRGFRRGRFTVCNVAAPS
ATQQEAKAAGAKESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTV
RSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRERVLEGEKLPVVTAKITMVDLPLGATE
DRVCGTIDIEKALTDGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTV
EREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFD
RDPKAFRESYLEEQDKLQQQISSARSNLGAVQIDHDLRVKISKVCAELNVDGLRGDIVTN
RAAKALAALKGRDTVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVVEKFYEVFT
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgccttctcccccgccaccgccgcgcccgccgcgtcgccggccctcttctcc
gcctccacctcccggcctctctccctcaccgccgccgccgctgccgtctcagcccgtatc
ccgtcacggagagggttccgccgcggccgcttcaccgtctgcaatgtagccgccccctcc
gccacccagcaggaggctaaggcggcgggcgcgaaggagagccaacggccggtgtatccg
ttcgcggcgatcgtggggcaggacgagatgaagctgtgcctgctgctcaacgtcatcgac
cctaagatcggcggtgtcatgatcatgggagaccgtggcaccggcaaatccaccaccgtc
cgctcgctcgtcgacctgctcccggatatccgcgtcgttgttggcgaccctttcaattcc
gaccctgacgatcccgaggtcatgggccctgaggtccgggaacgcgtgctggagggtgag
aagcttcctgttgtcacggccaagatcaccatggtagatcttccccttggtgccactgag
gatagagtctgtggcaccattgatattgagaaggcgctcaccgatggtgtcaaggcgttc
gagcctggtttgcttgccaaggccaacagggggattctttatgtggatgaggtcaatttg
ttggatgaccatctagtagatgtgcttctggattctgctgcgtcaggatggaacaccgtg
gagagagagggtatctccatctcccaccctgctcggttcatcctcattgggtctggtaac
cccgaggaaggggagctccggccacagctgcttgaccggtttggcatgcacgcgcaggtt
ggtactgtcagggatgctgaactcagggtgaaaattgttgaagagagagctcggttcgac
agggatccaaaggcgttccgtgagtcctacttggaggaacaagacaagctccagcagcag
atttcatctgctcggagtaaccttggtgctgtgcagattgaccatgatcttcgtgttaag
atttctaaagtgtgtgcagagttgaatgttgatggattaagaggggacattgtgactaac
agggctgccaaggcgttggcagcactcaaaggcagggacactgtcactgtagaggacatt
gccactgttatccccaactgcttgaggcatcggcttcggaaggacccacttgaatcaatt
gactcaggattgctcgtggttgagaagttttatgaagtcttcacctaa

DBGET integrated database retrieval system