KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333851Help
Entry
4333851           CDS       T01015                                 

Definition
Os03g0704400
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 741 aa AA seqDB search
MERRDNFLQPPAAAAAPAAGGGKGLPVPATGDATNLTSSSSSTSSLTLSPPDFLRQVQAA
LKRHRPTGSMQSNQPRATRVLVSRGEGSTKAVANPSVAQNPEGKVMQQRRGLLGASRLRN
AAPDQNKAVVSSQDELLLTTPLTLGTITDTHDQNGGQNHQPKSDTDLLVDRKKSSMEVSS
SQMASANALVGEDFKKDLFYLTSDPQLTSQRDNFPVAQVADDQGKNHKEIGIASAAVEMD
IKYDAANLSRRIDEACDQNHGEPMTRCSAMGSSVTAVSLYSGPTIQSKSAAQIDQYASPA
QMPQCGRESSGVSGHGSQKLHGVAMNHADCNTNKQQVDTNGGMDKPVSSSAVCLPSQGLS
GNDQSLSAKDDGAPRRSKVEKECRKKNYDPDVFFKVNGKLYQKLGKIGSGGSSEVHKVIS
AECTIYALKKIKLKGRDYPTAYGFCQEIEYLNKLKGKSNIIQLIDYEVTDKSLLQDDSLS
PRDGRIKDDHYIYMVLEYGEIDLANMVAQEWKKRNTSNMKIDENWLRFYWQQMLKAVNTI
HEERIVHSDLKPANFLLVRGALKLIDFGIAKAIMNDTTNIQRDSQIGTLNYMSPEAFMCN
EQDSGGNVIKCGRPSDIWSLGCILYQMVYGKTPFADYKNFWAKFKVVTDKNHKIKYEPVD
NPWLIDLMQRCLAWDRNDRWRIPQLLEHPFLVPLVPRDLPSIDQDPCRLLMERVRVHWAN
PKLHSFIAELEKDQCRPATQM
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggagaggagggataatttccttcagccccctgccgccgccgccgccccagccgccggc
ggcggaaagggcctcccggtccccgccacaggggacgcgacgaacctgacctcgtcgtcg
agctccacctcctccctcacgctgtcccctccggacttcctgcgtcaggttcaggccgcg
ctgaagcggcataggcctaccggttcgatgcagtccaatcaaccacgagcaacccgagtc
ctggtgtcccgaggtgagggctcaacgaaagctgttgccaacccttctgtggcacaaaat
ccggaaggcaaggttatgcagcagaggagaggcctgctgggggcttccaggttgcgaaat
gcagctcctgatcagaacaaagctgttgtctcaagtcaagacgaattgttgttgactacg
cctttgacattgggaactatcactgatacccatgatcagaatggtggtcagaaccaccag
ccgaaaagtgacactgatctcttggtggataggaagaaatcgtcaatggaagtttcttcc
tcccagatggcatccgcaaatgcattggtaggggaagatttcaaaaaagacctattctat
ttgactagcgatccgcagttaacttctcagagagataattttcctgtcgctcaagtagca
gatgatcaaggcaagaaccacaaggagattgggattgctagtgcagcagttgagatggat
atcaagtatgatgcagctaacttgtcccgaagaattgatgaggcttgtgatcagaatcat
ggagagccaatgactcgttgctctgccatgggttcatcagtgactgctgtatctttatat
tcagggcctactattcaaagtaaaagtgctgctcagattgatcaatatgcttcaccagct
cagatgccacaatgtggcagagaatcatctggtgtatcaggtcatggctctcaaaaactg
catggagtggcaatgaatcatgctgattgcaataccaacaaacagcaggttgataccaat
ggtgggatggacaaacctgtttctagtagtgcagtttgtttgccatcccaagggttatct
gggaatgatcaatctttgtctgccaaggatgatggtgctcctagacgaagcaaggttgaa
aaggagtgtcgcaaaaagaattatgatccggatgtattctttaaagtgaatggaaaactt
tatcagaagctaggtaaaatagggtctggaggcagcagtgaagttcacaaagttatatca
gccgagtgtacaatatatgccctgaaaaaaataaaacttaaaggtcgggactaccctact
gcctatggcttttgccaagaaattgagtacctaaacaagttgaaaggaaagagtaatatc
atacagttgattgattatgaggtcactgataaaagtttgcttcaagatgattcgctgtca
cccagagatgggagaattaaggatgatcactacatttatatggtccttgagtatggtgaa
attgatttagctaatatggttgctcaggagtggaagaagaggaacacctcaaatatgaaa
atagatgaaaattggctacgtttttattggcagcaaatgcttaaagctgtcaatacaata
catgaggaacggatagtgcactccgatttgaagcctgcaaattttttgcttgtgaggggt
gcactgaaacttattgactttggcattgctaaagcaataatgaatgataccacaaacatt
caacgtgattctcagattggaacactgaactatatgtcacctgaagcattcatgtgcaat
gagcaggactcgggtggtaatgttatcaagtgtggacgtccatctgatatttggtctctt
ggttgtattctttaccagatggtgtatggtaagacaccatttgctgattacaagaatttc
tgggccaagtttaaagttgttactgataagaaccacaagatcaagtatgaaccggtagat
aatccatggcttattgatttaatgcaacgatgccttgcatgggaccgaaatgatcgatgg
agaatacctcaattgcttgagcacccgttccttgttcctttggttccaagggatttacct
tcaattgaccaagacccgtgtaggttgctgatggagagggttagagttcactgggccaat
cccaagcttcatagttttattgcagagctcgagaaggatcaatgccgtccagccactcaa
atgtaa

DBGET integrated database retrieval system