KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333851Help
Entry
4333851           CDS       T01015                                 

Definition
(RefSeq) dual specificity tyrosine-phosphorylation-regulated kinase mbk-1
  KO
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     4333851
Protein kinases [BR:osa01001]
 Serine/threonine protein kinases: Other group
  TTK family
   4333851
Chromosome [BR:osa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     4333851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 767 aa AA seqDB search
MERRDNFLQPPAAAAAPAAGGGKGLPVPATGDATNLTSSSSSTSSLTLSPPDFLRQVQAA
LKRHRPTGSMQSNQPRATRVLVSRGEGSTKAVANPSVAQNPEGKVMQQRRGLLGASRLRN
AAPDQNKAVVSSQDELLLTTPLTLGTITDTHDQNGGQNHQPKSDTDLLVDRKKSSMEVSS
SQMASANALVGEDFKKDLFYLTSDPQLTSQSDNVGVTAGSRMDSMLSYLHSVSLTAGDNF
PVAQVADDQGKNHKEIGIASAAVEMDIKYDAANLSRRIDEACDQNHGEPMTRCSAMGSSV
TAVSLYSGPTIQSKSAAQIDQYASPAQMPQCGRESSGVSGHGSQKLHGVAMNHADCNTNK
QQVDTNGGMDKPVSSSAVCLPSQGLSGNDQSLSAKDDGAPRRSKVEKECRKKNYDPDVFF
KVNGKLYQKLGKIGSGGSSEVHKVISAECTIYALKKIKLKGRDYPTAYGFCQEIEYLNKL
KGKSNIIQLIDYEVTDKSLLQDDSLSPRDGRIKDDHYIYMVLEYGEIDLANMVAQEWKKR
NTSNMKIDENWLRFYWQQMLKAVNTIHEERIVHSDLKPANFLLVRGALKLIDFGIAKAIM
NDTTNIQRDSQIGTLNYMSPEAFMCNEQDSGGNVIKCGRPSDIWSLGCILYQMVYGKTPF
ADYKNFWAKFKVVTDKNHKIKYEPVDNPWLIDLMQRCLAWDRNDRWRIPQLLEHPFLVPL
VPRDLPSIDQDPCRLLMERVRVHWANPKLHSFIAELEKDQCRPATQM
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggagaggagggataatttccttcagccccctgccgccgccgccgccccagccgccggc
ggcggaaagggcctcccggtccccgccacaggggacgcgacgaacctgacctcgtcgtcg
agctccacctcctccctcacgctgtcccctccggacttcctgcgtcaggttcaggccgcg
ctgaagcggcataggcctaccggttcgatgcagtccaatcaaccacgagcaacccgagtc
ctggtgtcccgaggtgagggctcaacgaaagctgttgccaacccttctgtggcacaaaat
ccggaaggcaaggttatgcagcagaggagaggcctgctgggggcttccaggttgcgaaat
gcagctcctgatcagaacaaagctgttgtctcaagtcaagacgaattgttgttgactacg
cctttgacattgggaactatcactgatacccatgatcagaatggtggtcagaaccaccag
ccgaaaagtgacactgatctcttggtggataggaagaaatcgtcaatggaagtttcttcc
tcccagatggcatccgcaaatgcattggtaggggaagatttcaaaaaagacctattctat
ttgactagcgatccgcagttaacttctcagagtgataatgtaggtgtaactgctggtagt
agaatggacagtatgttgtcttatcttcattctgtttcattgacagcaggagataatttt
cctgtcgctcaagtagcagatgatcaaggcaagaaccacaaggagattgggattgctagt
gcagcagttgagatggatatcaagtatgatgcagctaacttgtcccgaagaattgatgag
gcttgtgatcagaatcatggagagccaatgactcgttgctctgccatgggttcatcagtg
actgctgtatctttatattcagggcctactattcaaagtaaaagtgctgctcagattgat
caatatgcttcaccagctcagatgccacaatgtggcagagaatcatctggtgtatcaggt
catggctctcaaaaactgcatggagtggcaatgaatcatgctgattgcaataccaacaaa
cagcaggttgataccaatggtgggatggacaaacctgtttctagtagtgcagtttgtttg
ccatcccaagggttatctgggaatgatcaatctttgtctgccaaggatgatggtgctcct
agacgaagcaaggttgaaaaggagtgtcgcaaaaagaattatgatccggatgtattcttt
aaagtgaatggaaaactttatcagaagctaggtaaaatagggtctggaggcagcagtgaa
gttcacaaagttatatcagccgagtgtacaatatatgccctgaaaaaaataaaacttaaa
ggtcgggactaccctactgcctatggcttttgccaagaaattgagtacctaaacaagttg
aaaggaaagagtaatatcatacagttgattgattatgaggtcactgataaaagtttgctt
caagatgattcgctgtcacccagagatgggagaattaaggatgatcactacatttatatg
gtccttgagtatggtgaaattgatttagctaatatggttgctcaggagtggaagaagagg
aacacctcaaatatgaaaatagatgaaaattggctacgtttttattggcagcaaatgctt
aaagctgtcaatacaatacatgaggaacggatagtgcactccgatttgaagcctgcaaat
tttttgcttgtgaggggtgcactgaaacttattgactttggcattgctaaagcaataatg
aatgataccacaaacattcaacgtgattctcagattggaacactgaactatatgtcacct
gaagcattcatgtgcaatgagcaggactcgggtggtaatgttatcaagtgtggacgtcca
tctgatatttggtctcttggttgtattctttaccagatggtgtatggtaagacaccattt
gctgattacaagaatttctgggccaagtttaaagttgttactgataagaaccacaagatc
aagtatgaaccggtagataatccatggcttattgatttaatgcaacgatgccttgcatgg
gaccgaaatgatcgatggagaatacctcaattgcttgagcacccgttccttgttcctttg
gttccaagggatttaccttcaattgaccaagacccgtgtaggttgctgatggagagggtt
agagttcactgggccaatcccaagcttcatagttttattgcagagctcgagaaggatcaa
tgccgtccagccactcaaatgtaa

DBGET integrated database retrieval system