KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334040Help
Entry
4334040           CDS       T01015                                 

Definition
(RefSeq) cyclin-H1-1 isoform X1
  KO
K06634  cyclin H
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
osa03420  Nucleotide excision repair
Module
osa_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    4334040
  Replication and repair
   03420 Nucleotide excision repair
    4334040
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4334040
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4334040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N TFIIB RB_B NMT_C
Motif
Other DBs
NCBI-GeneID: 4334040
NCBI-ProteinID: XP_015628150
UniProt: Q10D80
Position
3
AA seq 330 aa AA seqDB search
MADFRTSTHRERWIFQTNDLMDRWGAANQRATETLVQYGTTRLKVDPVDGSLSYPEPAPD
HVVGSSGVKPLSCEEERLMRVFYEQKIQEVCSAFKFPHKIQATAIIYFKRFYLQWSVMEH
HPKHIMLTCIYSSCKVEENHVSAEELGKGIQQDHQIILNNEMIVLKSLDFDLIVYAPYRS
IEGFVDDMEDFCRAGNGEHQRLQDLRQTAISQVDKMMLTDAPLLYTPGQLALAALHKSND
MHKILNFERYLESVFSRQHSDCPIEQFVGSINMINYLVEQLKIPTPKDMRHIDRKLKHCL
DPSSQDEHKKKEKKSKHKSKRAANEAQLDS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttccggacctccacgcatcgggagaggtggatcttccagacgaacgatctg
atggatagatggggggcggcgaaccagcgggccacggagacgctcgttcagtatggaacg
acgcggttgaaggtggaccctgttgatgggtcgctgtcgtacccggaacctgcgcctgat
catgttgtagggagctcaggtgtaaagcctctgtcttgtgaagaggagcgattgatgcgg
gtattttatgagcaaaagattcaagaagtatgttcagcatttaagttccctcacaaaatc
caggctaccgcaataatatatttcaagagattttatctgcaatggtctgtaatggaacat
cacccaaagcatattatgttaacttgtatttattcttcttgcaaagtggaagaaaatcat
gtttctgctgaggaacttggtaaaggaattcaacaggaccaccagattattctaaataac
gagatgattgttctcaaatctttagattttgatctgattgtttatgctccgtatcgatct
atcgaaggatttgttgatgacatggaggatttctgcagagcaggtaatggtgagcaccaa
cggttgcaggatttacgtcaaactgcgatatctcaggttgacaaaatgatgttgactgac
gctcctcttctctacactcctggacagttggctctggctgctttgcacaaatccaatgat
atgcacaagatccttaattttgaaaggtacttggaaagtgttttttcaaggcaacattct
gattgtccaatcgaacaatttgttgggtcaatcaatatgatcaattatttggttgagcag
cttaaaatacctactcctaaggacatgaggcatattgaccgcaagcttaagcattgtttg
gatccaagctcacaggatgagcataagaagaaagagaagaagtcgaagcacaaatcaaaa
agggcagctaatgaagcccaacttgacagctag

DBGET integrated database retrieval system