KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334058Help
Entry
4334058           CDS       T01015                                 

Definition
Os03g0740800
Orthology
K10886  
DNA-repair protein XRCC4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    4334058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 274 aa AA seqDB search
MATSTAAPRHSCAKLSVAVEDPKAGGGGAVFVKATWHPTRFSLAVTDGGAAWVAQASDAE
VRLRAEQWDQPVADYLALAERYLAFQQPSSTYSFHDAANGNRRLSWTFEKQGTKLEWRWK
LQPAPNTQQTIAEILDFLMDANIRLSEEVVRKTQSFDKLKQESEKCLQQSERFNIEKAEF
EQSTFSKFVAVLNSKKAKLRQLKDKLTEFESADKAPKEEDENSTDKTELFEEASDKDASV
NDEPSETGGGDLHSSPEKTAATSRGGRGRKRTRK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctcgacggcggcgcccaggcacagctgcgcgaagctctcggtggcggtggag
gaccccaaggcgggcggcggcggagccgtcttcgtgaaggccacgtggcaccccacgcgc
ttctccctcgccgtcaccgacggcggcgccgcgtgggtcgcccaggcctccgacgccgag
gtgcgcctccgcgccgagcagtgggaccagcccgtcgccgactacctcgccctcgccgag
cgctacctcgccttccagcagccctcctccacctactccttccacgacgccgccaacggc
aatcgaaggctgtcatggacatttgagaaacaaggcaccaagttagaatggcgatggaaa
ctgcagcctgcacctaacactcagcagactatagctgagatcttggattttcttatggat
gcaaatatacgcttgagcgaagaggttgttaggaaaacacaatcctttgacaagttgaaa
caagaatctgagaagtgcttgcaacaaagtgaaagatttaacattgagaaagctgagttc
gaacaatccacattttcaaagtttgtggctgtcttaaattcgaagaaagccaagctcaga
caactcaaggacaaactcacagaatttgaatctgctgacaaggctccaaaggaggaggat
gagaactccactgataagacagagctttttgaggaagcaagtgacaaagatgcaagcgtt
aatgatgaaccctctgagactggtggcggcgatcttcatagctctcctgagaaaactgca
gccacctccagaggggggaggggtcgcaagaggactagaaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system