KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334145Help
Entry
4334145           CDS       T01015                                 

Definition
(RefSeq) Os03g0754200
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4334145
   01230 Biosynthesis of amino acids
    4334145
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4334145
   00051 Fructose and mannose metabolism
    4334145
   00562 Inositol phosphate metabolism
    4334145
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4334145
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     4334145
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4334145
  Exosomal proteins of bladder cancer cells
   4334145
  Exosomal proteins of melanoma cells
   4334145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 79 aa AA seqDB search
RRHNFPHFVCWLCTLKKLASRVHGGLRKLLTTNVRIHMNHLCRSCTASNCKELAVQPDLN
GFLVSGASLKVKRNTNILE
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
agaagacataattttccccattttgtttgttggctctgtactctcaagaaactagcttcc
agagtgcatggaggcctgaggaagttgctcactactaatgtcagaatccacatgaatcat
ctatgcaggtcctgtactgcttcgaactgcaaggaactggcagtacaacctgatcttaat
ggttttcttgtcagtggagcttcattgaaggtaaagaggaatacaaacatattagaataa

DBGET integrated database retrieval system