KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334145Help
Entry
4334145           CDS       T01015                                 

Definition
Os03g0754200
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4334145
   01230 Biosynthesis of amino acids
    4334145
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4334145
   00051 Fructose and mannose metabolism
    4334145
   00562 Inositol phosphate metabolism
    4334145
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4334145
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     4334145
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4334145
  Exosomal proteins of bladder cancer cells
   4334145
  Exosomal proteins of melanoma cells
   4334145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 79 aa AA seqDB search
RRHNFPHFVCWLCTLKKLASRVHGGLRKLLTTNVRIHMNHLCRSCTASNCKELAVQPDLN
GFLVSGASLKVKRNTNILE
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
agaagacataattttccccattttgtttgttggctctgtactctcaagaaactagcttcc
agagtgcatggaggcctgaggaagttgctcactactaatgtcagaatccacatgaatcat
ctatgcaggtcctgtactgcttcgaactgcaaggaactggcagtacaacctgatcttaat
ggttttcttgtcagtggagcttcattgaaggtaaagaggaatacaaacatattagaataa

DBGET integrated database retrieval system