KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334425Help
Entry
4334425           CDS       T01015                                 

Definition
Os03g0797000
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    4334425
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4334425
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4334425
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     4334425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 279 aa AA seqDB search
MEMEDSGRGVVGAGKRGVAETFSRLREQGKTAFIPFITASDPDLATTSKALKILDSCGSD
VIELGVPYSDPLADGPVIQAAATRALKKGATFDSVIAMLKGVIPELSCPIVIFTYYNPIL
KRGVSNFMAIIKQAGVHGLVVPDLPLEETALLRNEAVMHGIELVLLTTPTTPTERMKEIA
KASEGFIYLVSSVGVTGARSNVNLRVEYLLQEIKKVTDKPVAVGFGISTPEHVKQIAGWG
ADGVIIGSAIVRQLGEAASPEEGLKRVEEYAKNMKAAMP
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaagatagcggtcgcggcgtcgtgggcgccgggaagcgcggcgtcgcggag
accttctccaggctccgggagcagggcaagactgcattcattccattcatcaccgccagt
gaccctgacttggcaaccacatcgaaagcgttgaagatccttgattcctgtggttcagat
gtgattgagctgggtgtaccttactcggatccgttggctgatgggccggttattcaggct
gcagcaacgcgtgctcttaagaaaggcgctacatttgattccgtcatagctatgctcaag
ggggttatacctgagttgtcttgtccaatagttatcttcacatactacaacccaatttta
aagcgcggagtgagtaacttcatggctatcattaaacaagccggcgtacatggtcttgta
gtacctgatcttcctttggaagagacagcgctgttgaggaatgaggctgtcatgcatggc
atagagctggtgctgcttacaacaccaaccacaccaacagagaggatgaaggagattgca
aaagcttcagaaggatttatttatcttgtaagttctgttggagttacaggtgcacgctca
aatgtaaatttgcgtgttgagtaccttcttcaggagatcaagaaggttacagacaaacct
gttgctgttggctttggcatatcgactccagagcatgtaaagcagattgcaggctgggga
gcagatggtgtgatcatcggcagcgctattgttagacagttaggagaggctgcttcacct
gaagaagggttgaaaagagtagaagagtatgccaagaacatgaaggctgctatgccttga

  All links  
No link information was found.   
DBGET integrated database retrieval system