KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334425Help
Entry
4334425           CDS       T01015                                 

Definition
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4334425
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4334425
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     4334425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth FMN_dh ThiG PcrB BtpA NanE IGPS TMP-TENI Ribul_P_3_epim
Motif
Other DBs
NCBI-GeneID: 4334425
NCBI-ProteinID: XP_015628215
UniProt: Q7Y1H9
Position
3
AA seq 279 aa AA seqDB search
MEMEDSGRGVVGAGKRGVAETFSRLREQGKTAFIPFITASDPDLATTSKALKILDSCGSD
VIELGVPYSDPLADGPVIQAAATRALKKGATFDSVIAMLKGVIPELSCPIVIFTYYNPIL
KRGVSNFMAIIKQAGVHGLVVPDLPLEETALLRNEAVMHGIELVLLTTPTTPTERMKEIA
KASEGFIYLVSSVGVTGARSNVNLRVEYLLQEIKKVTDKPVAVGFGISTPEHVKQIAGWG
ADGVIIGSAIVRQLGEAASPEEGLKRVEEYAKNMKAAMP
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaagatagcggtcgcggcgtcgtgggcgccgggaagcgcggcgtcgcggag
accttctccaggctccgggagcagggcaagactgcattcattccattcatcaccgccagt
gaccctgacttggcaaccacatcgaaagcgttgaagatccttgattcctgtggttcagat
gtgattgagctgggtgtaccttactcggatccgttggctgatgggccggttattcaggct
gcagcaacgcgtgctcttaagaaaggcgctacatttgattccgtcatagctatgctcaag
ggggttatacctgagttgtcttgtccaatagttatcttcacatactacaacccaatttta
aagcgcggagtgagtaacttcatggctatcattaaacaagccggcgtacatggtcttgta
gtacctgatcttcctttggaagagacagcgctgttgaggaatgaggctgtcatgcatggc
atagagctggtgctgcttacaacaccaaccacaccaacagagaggatgaaggagattgca
aaagcttcagaaggatttatttatcttgtaagttctgttggagttacaggtgcacgctca
aatgtaaatttgcgtgttgagtaccttcttcaggagatcaagaaggttacagacaaacct
gttgctgttggctttggcatatcgactccagagcatgtaaagcagattgcaggctgggga
gcagatggtgtgatcatcggcagcgctattgttagacagttaggagaggctgcttcacct
gaagaagggttgaaaagagtagaagagtatgccaagaacatgaaggctgctatgccttga

DBGET integrated database retrieval system