KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334537Help
Entry
4334537           CDS       T01015                                 

Definition
(RefSeq) magnesium-chelatase subunit ChlD, chloroplastic
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin and chlorophyll metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    4334537
Enzymes [BR:osa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     4334537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA MCM AAA_5 Sigma54_activat VWA_3 RXT2_N CCDC53 PAXIP1_C CDC45 AAA_2 CAP_N
Motif
Other DBs
NCBI-GeneID: 4334537
NCBI-ProteinID: XP_015631084
UniProt: Q6ATS0
Position
3
AA seq 754 aa AA seqDB search
MAMATTALSASLPRLLPPRRRRFPTPSSSSPSAASTSTSRVVRLRAAAASAPSEVLDSTN
GAIPSGKGGGGQQYGREYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGTAKTVMA
RGLHAMLPPIEVVVGSIANADPNYPEEWEEGLANQVQYDADGNLKTEIIKTPFVQIPLGI
TEDRLIGSVDVEASVKSGTTVFQPGLLAEAHRGVLYVDEINLLDEGVSNLLLNVLTEGVN
IVEREGISFRHPCKPLLIATYNPEEGSVREHLLDRIAINLSADLPMSFDDRVAAVDIATQ
FQESSKEVFKMVEEETEVAKTQIILAREYLKDVAISTEQLKYLVMEAIRGGCQGHRAELY
AARVAKCLAAMEGREKVYVDDLKKAVELVILPRSILSDNPQEQQDQQPPPPPPPPPPQDQ
DSQEDQDEDEEEDQEDDDEENEQQDQQIPEEFIFDAEGGIVDEKLLFFAQQAQRRRGKAG
RAKNLIFSSDRGRYIGSMLPKGPIRRLAVDATLRAAAPYQKLRREKDRDKTRKVFVEKTD
MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRGDFA
EVLLPPSRSIAMARNRLEKLPCGGGSPLAHGLSTAVRVGLNAEKSGDVGRIMIVAITDGR
ANVSLKKSTDPEATSDAPRPSSQELKDEILEVAGKIYKAGISLLVIDTENKFVSTGFAKE
IARVAQGKYYYLPNASDAVISAATKTALSDLKSS
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggccaccaccgcgctctccgcctccctcccgcgcctactcccgcctcgccgc
cgccgcttcccgacgccctcctcctcctccccctccgccgcatccacctccacctcccgc
gtcgtccgcctgcgggccgccgcggcctcggcgccatccgaggtcctcgactccaccaac
ggggccatcccctcggggaagggcggcggcgggcagcagtacgggagggagtatttcccc
ttggccgctgtcgtcgggcaggatgcaattaaaactgctctgctgcttggggcaattgac
cgtgaaattggaggcatcgccatctcagggaagcgtgggacagcaaagacagtgatggct
cgtggcttgcacgctatgcttccacctattgaagtggttgtaggctcgattgcaaatgct
gaccctaactacccagaagaatgggaggagggtttggctaaccaagttcaatatgatgct
gatggtaacttgaagaccgagattatcaaaacaccttttgtgcagatcccgcttggtatc
actgaggataggttaatcggatcagtcgatgttgaagcatctgtgaaatcaggaactact
gtgtttcaacctggccttcttgctgaagctcacagaggcgttctttatgttgatgagata
aatctattggatgagggcgtaagcaatctacttctgaatgtcttgactgagggagtcaat
attgtggaaagagagggcattagctttcgtcatccatgcaaaccacttctaattgctact
tacaacccagaggaaggatctgtacgtgaacacttacttgatcgtattgcaattaattta
agcgctgatctgccaatgagttttgatgatcgtgtggcagctgtggatattgcaacacaa
tttcaagagtccagcaaagaggtttttaaaatggtggaagaagaaactgaggttgcaaaa
acccagataattttggcaagagaatatctgaaagatgttgcaatcagcacagagcagctc
aaatatcttgtcatggaagctatacgcggtggctgtcaggggcaccgggctgagctgtat
gctgctcgagtggcaaaatgtcttgctgctatggaagggcgtgaaaaagtatatgtggat
gaccttaagaaagctgtagagctagttattctacctcgatcaatcctatctgataaccca
caggagcagcaagaccaacaacctcctccacccccaccgccaccccctccacaagatcaa
gattctcaagaagatcaagatgaagacgaggaagaggaccaagaggacgatgatgaagaa
aatgaacagcaggaccagcagatacctgaggagttcatttttgatgctgaaggtggtata
gtagatgagaagctccttttctttgctcagcaagctcaaagacggcgagggaaagctgga
cgagcaaagaatctcatattctcatctgataggggacgatacataggttctatgcttccc
aagggtccaataaggaggttagctgttgatgccacacttcgagcagctgcaccataccag
aaactgaggagagagaaagatcgtgacaagacaagaaaggtttttgttgaaaaaactgac
atgagagccaaaagaatggctcgaaaagcaggcgcactggtcatatttgttgtggatgct
agcggtagcatggctctgaatcgcatgcagaatgcgaaaggtgcagcattaaagttgctt
gcagaaagctacacaagcagagatcaggtttcaatcattccatttcgtggagattttgct
gaggttcttcttccaccttcaagatccatagcaatggcccgcaatcgtcttgagaagcta
ccatgtggtggcggttctcctttagctcacggccttagcacagctgtcagagtgggtttg
aatgctgaaaagagcggtgatgttggacgtatcatgattgttgcaatcaccgatggaaga
gctaatgtgtcactgaagaaatcgactgacccagaagccacttcagatgctccaagacct
tcttctcaagaattaaaggatgagatacttgaggtggctggcaaaatatacaaggctgga
atttcacttcttgttattgataccgagaacaagtttgtatccacaggatttgccaaggaa
attgcaagggtcgcccaaggtaaatactattacctgccgaatgcttcagacgctgttatt
tccgccgccaccaagactgcactctcggacctgaagagttcgtga

DBGET integrated database retrieval system