KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334588Help
Entry
4334588           CDS       T01015                                 

Definition
Os03g0819600
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    4334588
Enzymes [BR:osa01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     4334588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 233 aa AA seqDB search
MAAVSEVEVDGVVFPPVARPPGSGHAHFLAGAGVRGVEIAGNFIKFTAIGVYLEEGAAVP
ALAKKWAGKSADELAADAAFFRDVVTGDFEKFTRVTMILPLTGEQYSDKVTENCVAAWKA
AGVYTDAEGAAADKFKEAFKPHSFPPGASILFTHSPPGVLTVAFSKDSSVPEGAVAAAAI
ENRALCEAVLDSIIGEHGVSPAAKRSIAARVSQLLKAESTGDVAAAEPAPVSA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgtcggaggtggaggtcgacggcgtcgtgttcccgccggtggcccgcccg
ccgggctccggccacgcccacttcctcgccggcgcaggtgtgaggggagtggagatcgcc
ggcaacttcatcaagttcacggccatcggcgtgtacctggaggagggcgcggccgtgccg
gcgctggccaagaagtgggccggcaagtccgccgacgagctcgccgccgacgccgccttc
ttccgcgacgtcgtcaccggcgatttcgagaagttcacgagggtgacgatgatcctgccg
ctcaccggcgagcagtactcggacaaggtgacggagaactgcgtcgcggcgtggaaggcc
gccggcgtgtacacggacgccgagggcgcggccgcggacaagttcaaggaggccttcaag
ccccacagcttccctccgggcgcgtccatcctcttcacccactccccgcccggcgtcctc
accgtcgcgttctccaaggactcgtcggtgccagagggcgccgtggcggcggcggcgatc
gagaacagggcgctctgcgaggcggtgctggattccatcatcggcgagcacggggtctcg
ccggcggcgaagcggagcatagcggcccgcgtctcgcagctcctgaaggcggaatccacc
ggcgacgtggcggcggcggagcccgcgccggtgtccgcgtga

DBGET integrated database retrieval system