KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334912Help
Entry
4334912           CDS       T01015                                 

Definition
(RefSeq) arginase 1, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    4334912
   00330 Arginine and proline metabolism
    4334912
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     4334912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 4334912
NCBI-ProteinID: XP_015636156
UniProt: Q7X7N2
Position
4
AA seq 340 aa AA seqDB search
MGGVAAGTRWIHHVRRLSAAKVSADALERGQSRVIDASLTLIRERAKLKAELLRALGGVK
ASACLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSSTEEGKELNDPRVLTDVGDVPI
QEIRDCGVEDDRLMNVVSESVKTVMEEDPLRPLVLGGDHSISYPVVRAVSEKLGGPVDIL
HLDAHPDIYDAFEGNIYSHASSFARIMEGGYARRLLQVGIRSITKEGREQGKRFGVEQYE
MRTFSKDREKLESLKLGEGVKGVYISVDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNL
QGDVVAGDVVEFNPQRDTVDGMTAMVAAKLVRELTAKISK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgtggcggcgggcaccaggtggatccaccacgtccggcggctcagcgccgcc
aaggtgtcggcggacgccctggagcgcggccagagccgggtcatcgacgcctccctcacc
ctcatccgcgagcgcgccaagctcaaggcagagttgctgcgcgctcttggtggtgtgaaa
gcttcagcatgcctcttaggtgttcctcttggtcacaactcatcgttcttacagggacct
gcatttgctcctccccggataagggaagccatttggtgtggaagtaccaactctagcaca
gaagaaggcaaagaactcaatgatcctcgagtgctaacagatgttggtgatgtccccata
caagagattcgtgactgtggtgttgaagatgacagattgatgaatgttgtaagcgagtct
gtcaaaacagtgatggaggaagatcctcttcggccattggtcctgggaggcgatcactca
atatcttatccagttgttagggctgtgtctgaaaagcttggtggacctgttgacattctt
caccttgacgcacatccagatatctacgatgcttttgaaggaaacatctattcgcatgct
tcttcatttgcaagaataatggaaggaggttatgctaggaggcttctacaggttggaatc
agatcaattaccaaagaagggcgtgagcaggggaagagatttggtgtggaacagtatgag
atgcgcactttttcaaaagatagggagaagcttgaaagtctgaaacttggggaaggtgtg
aagggagtgtacatctcagttgacgtggactgcctcgatcccgctttcgcgccaggtgtc
tctcacattgagccaggaggcctctccttccgcgacgtgctcaacatcctccataacctg
caaggagatgttgtcgccggagatgtggtggagttcaacccgcagcgtgacacggtggac
gggatgacggctatggttgcagccaagctggtccgggagctcacagccaagatctccaag
tga

DBGET integrated database retrieval system