KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334912Help
Entry
4334912           CDS       T01015                                 

Definition
Os04g0106300
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    4334912
  Amino acid metabolism
   00330 Arginine and proline metabolism
    4334912
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     4334912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 340 aa AA seqDB search
MGGVAAGTRWIHHVRRLSAAKVSADALERGQSRVIDASLTLIRERAKLKAELLRALGGVK
ASACLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSSTEEGKELNDPRVLTDVGDVPI
QEIRDCGVEDDRLMNVVSESVKTVMEEDPLRPLVLGGDHSISYPVVRAVSEKLGGPVDIL
HLDAHPDIYDAFEGNIYSHASSFARIMEGGYARRLLQVGIRSITKEGREQGKRFGVEQYE
MRTFSKDREKLESLKLGEGVKGVYISVDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNL
QGDVVAGDVVEFNPQRDTVDGMTAMVAAKLVRELTAKISK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgtggcggcgggcaccaggtggatccaccacgtccggcggctcagcgccgcc
aaggtgtcggcggacgccctggagcgcggccagagccgggtcatcgacgcctccctcacc
ctcatccgcgagcgcgccaagctcaaggcagagttgctgcgcgctcttggtggtgtgaaa
gcttcagcatgcctcttaggtgttcctcttggtcacaactcatcgttcttacagggacct
gcatttgctcctccccggataagggaagccatttggtgtggaagtaccaactctagcaca
gaagaaggcaaagaactcaatgatcctcgagtgctaacagatgttggtgatgtccccata
caagagattcgtgactgtggtgttgaagatgacagattgatgaatgttgtaagcgagtct
gtcaaaacagtgatggaggaagatcctcttcggccattggtcctgggaggcgatcactca
atatcttatccagttgttagggctgtgtctgaaaagcttggtggacctgttgacattctt
caccttgacgcacatccagatatctacgatgcttttgaaggaaacatctattcgcatgct
tcttcatttgcaagaataatggaaggaggttatgctaggaggcttctacaggttggaatc
agatcaattaccaaagaagggcgtgagcaggggaagagatttggtgtggaacagtatgag
atgcgcactttttcaaaagatagggagaagcttgaaagtctgaaacttggggaaggtgtg
aagggagtgtacatctcagttgacgtggactgcctcgatcccgctttcgcgccaggtgtc
tctcacattgagccaggaggcctctccttccgcgacgtgctcaacatcctccataacctg
caaggagatgttgtcgccggagatgtggtggagttcaacccgcagcgtgacacggtggac
gggatgacggctatggttgcagccaagctggtccgggagctcacagccaagatctccaag
tga

DBGET integrated database retrieval system