KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335342Help
Entry
4335342           CDS       T01015                                 

Definition
Os04g0271000
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     4335342
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 483 aa AA seqDB search
MSLGYAEKLSYREDVGNVGMPEIFDSPELLHKKIEELAVMVRESKHLVVFTGAGISTSSG
IPDFRGPKGVWTLQRSGKGVPGASLPFHRAVPTLTHMALVELEKTGRLKFVISQNVDSLH
LRSGLPREKLAELHGNSFKEICPSCKKEYLRDFEIETIGLKDTPRRCSDKNCGARLKDTV
LDWEDALPPEEMDAAKEQCQKADLVLCLGTSLQITPACNMPLLSLKNGGRVAIVNLQATP
KDKKASLVIHGLVDKVIAGVMYMMNLRIPPYIRTDFVQISLRNSVKKKCVRWTLRVTSIH
GLRAPLPFLRSVEVSFPERPDMKPVVLKEQPFSLQRETSMNRPFVMLLTFNFSDGCGCSS
SSIEWPVDFLKQKDSFVRDRSLVLQELQHAAEHRSRAGQHAILEREGVPRAETSIHALVT
NIVRYDTEDSKAAVPMATWMNSNGSLSKRHMDAIGCNPASSKKQKLVATRHRRKGLNPAT
QKV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttggctatgccgagaagctatcctaccgagaggatgtgggaaatgtcggcatg
cctgagatcttcgactctcctgaactcctccacaagaagatagaagagcttgcagtcatg
gtgcgagagagtaagcatttggtggtgtttactggagcaggcatatcaacttcatcaggc
atacctgacttccgagggcccaaaggcgtgtggacactgcagcgttcaggaaaaggtgtt
cctggtgcatcactgccgtttcaccgagctgttccaaccttgactcatatggcactggtt
gaattggaaaaaacaggacgattaaagtttgtcataagccagaatgttgatagcttacat
ctccgctctggcctcccaagggagaagctggctgaattgcatggaaattctttcaaggag
atctgcccaagctgtaaaaaggagtaccttcgtgattttgaaattgagacgataggactg
aaggatactccaaggcgttgttctgataagaactgtggagctagattaaaagacacagtt
cttgattgggaggatgctttaccccctgaggagatggatgctgccaaggagcagtgtcaa
aaagctgatcttgtcctatgtttaggaactagtctgcagattactcctgcttgtaatatg
cctctgttgtcactgaagaatggggggagggtggctattgtaaatcttcaggcaactccg
aaggataaaaaggcaagccttgtcattcatggacttgtggataaggtcattgctggggtt
atgtatatgatgaatctgcgtatccctccatatattcgtactgactttgttcaaattagt
ctccggaactcggtcaaaaaaaaatgcgtgagatggactctccgagtaacaagcattcat
ggcttgcgagcacctttgccatttcttcgatcagttgaggtttcctttcctgaaagacct
gacatgaagcctgtagtactaaaggagcaaccattttctttgcagagagaaacatcaatg
aatagaccgtttgtcatgctattgacattcaactttagtgatggttgcggctgttcgagc
tcttccattgaatggcctgttgattttctgaagcaaaaagacagctttgtcagggataga
agtctagtcctgcaagagttgcaacatgctgcagagcatcgatcacgtgcagggcagcat
gcaattctggagagggagggtgtgccaagagctgaaacgtcaattcatgcacttgtgacc
aacatcgtcaggtatgatactgaagatagcaaggcggcagttcccatggctacatggatg
aacagcaacggcagcctttcgaaacggcatatggatgccattggttgcaacccagcatcg
tcaaaaaagcagaagttggttgctactcgtcatcggcgaaagggcttgaaccctgctact
cagaaagtttga

DBGET integrated database retrieval system