KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335689Help
Entry
4335689           CDS       T01015                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 1, mitochondrial isoform X1
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00310  Lysine degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4335689
  Amino acid metabolism
   00310 Lysine degradation
    4335689
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     4335689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N GCV_H PYNP_C
Motif
Other DBs
NCBI-GeneID: 4335689
NCBI-ProteinID: XP_015636839
UniProt: Q7XVM2
Position
4
AA seq 440 aa AA seqDB search
MASRIASRLLRRSNATLGLIRSYSHARNYSSQLSALIPIGSQSSKLTRRRYYLPNASPYQ
LWSRSFASDNGDQVEAVVPFMGESVTDGTLANFLKKPGDRVEADEPIAQIETDKVTIDVA
SPEAGVIEKFIASEGDTVTPGTKVAIISKSAAPAETHVAPSEDSTPKETPPKAEETKPKL
EEKSPKAEPPKMPLPPKTSPTEPQLPPKERERRVPMPRLRKRIANRLKDSQNTFAMLTTF
NEVDMTNLMKLRSDYKDEFVTKHGVKLGLMSCFVKAAVTALQNQPIVNAVIDGDDIIYRD
YVDISVAVGTSKGLVVPVIRDADNMNFADIEKGINALAKKATEGALSIDEMAGGTFTISN
GGVYGSLISTPIINPPQSAILGMHSIVQRPVVVDGNILARPMMYLALTYDHRLIDGREAV
YFLRRIKDVVEDPRRLLLDI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccgcatcgcctctcgcctcctccgccgctccaacgcgactctaggcctcatc
aggagttattcacatgccaggaactacagcagtcaactttcagctcttattccaattggt
tcccagagctcaaagcttacaagaagacgctattacttgccaaatgcctctccgtaccaa
ctctggagtaggtcatttgcatctgacaatggagaccaggttgaagctgttgtccctttc
atgggtgaatctgtaactgatggaactcttgctaacttcttgaagaaacctggtgacaga
gttgaggctgatgagcccatagcacagattgaaactgataaggttactatagatgttgct
agtccggaagctggtgttattgaaaagttcattgctagcgaaggtgatactgttactcca
ggcaccaaagttgctatcatatcaaagtctgcggcaccagctgaaacacatgttgctccg
tctgaggattcaaccccaaaagaaacgcctccaaaagctgaggagacaaaaccaaaatta
gaagagaagtcaccaaaagcagaacctcccaagatgcctctgccacccaaaacctcccct
acagaaccacagctccctccaaaagaacgagaacggagggtgccaatgccaaggctcagg
aagcgtattgcaaaccgtttgaaggattcacaaaacacatttgcaatgctgaccacattt
aatgaagttgacatgactaatttgatgaagctgcggtctgattataaggatgagtttgtc
accaagcacggtgtcaaattgggtctgatgtcctgctttgtcaaggctgctgttacagca
cttcaaaaccaaccaattgtcaatgctgtcattgatggtgatgacatcatatacagagac
tatgttgacatcagtgttgctgttggtacttccaagggtcttgtggtgcctgttatccga
gatgctgataacatgaactttgcggacattgagaaagggataaacgcccttgcaaagaag
gctactgagggggcactctcaattgatgagatggcaggaggaacattcaccatctctaac
ggtggtgtttacggaagccttatcagcacacctatcatcaaccccccacagtctgctatt
cttggaatgcactccattgtacaacgccctgtggtcgtggacggcaacattctcgcgagg
ccaatgatgtaccttgcgctgacatatgaccacaggctgatcgacggcagagaagctgtc
tacttcctgcgccgcatcaaggacgtggttgaagacccacggagattgctcctcgacata
taa

DBGET integrated database retrieval system