KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335689Help
Entry
4335689           CDS       T01015                                 

Definition
Os04g0394200
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4335689
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4335689
  Amino acid metabolism
   00310 Lysine degradation
    4335689
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     4335689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 440 aa AA seqDB search
MASRIASRLLRRSNATLGLIRSYSHARNYSSQLSALIPIGSQSSKLTRRRYYLPNASPYQ
LWSRSFASDNGDQVEAVVPFMGESVTDGTLANFLKKPGDRVEADEPIAQIETDKVTIDVA
SPEAGVIEKFIASEGDTVTPGTKVAIISKSAAPAETHVAPSEDSTPKETPPKAEETKPKL
EEKSPKAEPPKMPLPPKTSPTEPQLPPKERERRVPMPRLRKRIANRLKDSQNTFAMLTTF
NEVDMTNLMKLRSDYKDEFVTKHGVKLGLMSCFVKAAVTALQNQPIVNAVIDGDDIIYRD
YVDISVAVGTSKGLVVPVIRDADNMNFADIEKGINALAKKATEGALSIDEMAGGTFTISN
GGVYGSLISTPIINPPQSAILGMHSIVQRPVVVDGNILARPMMYLALTYDHRLIDGREAV
YFLRRIKDVVEDPRRLLLDI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccgcatcgcctctcgcctcctccgccgctccaacgcgactctaggcctcatc
aggagttattcacatgccaggaactacagcagtcaactttcagctcttattccaattggt
tcccagagctcaaagcttacaagaagacgctattacttgccaaatgcctctccgtaccaa
ctctggagtaggtcatttgcatctgacaatggagaccaggttgaagctgttgtccctttc
atgggtgaatctgtaactgatggaactcttgctaacttcttgaagaaacctggtgacaga
gttgaggctgatgagcccatagcacagattgaaactgataaggttactatagatgttgct
agtccggaagctggtgttattgaaaagttcattgctagcgaaggtgatactgttactcca
ggcaccaaagttgctatcatatcaaagtctgcggcaccagctgaaacacatgttgctccg
tctgaggattcaaccccaaaagaaacgcctccaaaagctgaggagacaaaaccaaaatta
gaagagaagtcaccaaaagcagaacctcccaagatgcctctgccacccaaaacctcccct
acagaaccacagctccctccaaaagaacgagaacggagggtgccaatgccaaggctcagg
aagcgtattgcaaaccgtttgaaggattcacaaaacacatttgcaatgctgaccacattt
aatgaagttgacatgactaatttgatgaagctgcggtctgattataaggatgagtttgtc
accaagcacggtgtcaaattgggtctgatgtcctgctttgtcaaggctgctgttacagca
cttcaaaaccaaccaattgtcaatgctgtcattgatggtgatgacatcatatacagagac
tatgttgacatcagtgttgctgttggtacttccaagggtcttgtggtgcctgttatccga
gatgctgataacatgaactttgcggacattgagaaagggataaacgcccttgcaaagaag
gctactgagggggcactctcaattgatgagatggcaggaggaacattcaccatctctaac
ggtggtgtttacggaagccttatcagcacacctatcatcaaccccccacagtctgctatt
cttggaatgcactccattgtacaacgccctgtggtcgtggacggcaacattctcgcgagg
ccaatgatgtaccttgcgctgacatatgaccacaggctgatcgacggcagagaagctgtc
tacttcctgcgccgcatcaaggacgtggttgaagacccacggagattgctcctcgacata
taa

DBGET integrated database retrieval system