KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335689Help
Entry
4335689           CDS       T01015                                 

Definition
Os04g0394200
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:osa01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:osa00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:osa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 440 aa AA seqDB search
MASRIASRLLRRSNATLGLIRSYSHARNYSSQLSALIPIGSQSSKLTRRRYYLPNASPYQ
LWSRSFASDNGDQVEAVVPFMGESVTDGTLANFLKKPGDRVEADEPIAQIETDKVTIDVA
SPEAGVIEKFIASEGDTVTPGTKVAIISKSAAPAETHVAPSEDSTPKETPPKAEETKPKL
EEKSPKAEPPKMPLPPKTSPTEPQLPPKERERRVPMPRLRKRIANRLKDSQNTFAMLTTF
NEVDMTNLMKLRSDYKDEFVTKHGVKLGLMSCFVKAAVTALQNQPIVNAVIDGDDIIYRD
YVDISVAVGTSKGLVVPVIRDADNMNFADIEKGINALAKKATEGALSIDEMAGGTFTISN
GGVYGSLISTPIINPPQSAILGMHSIVQRPVVVDGNILARPMMYLALTYDHRLIDGREAV
YFLRRIKDVVEDPRRLLLDI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccgcatcgcctctcgcctcctccgccgctccaacgcgactctaggcctcatc
aggagttattcacatgccaggaactacagcagtcaactttcagctcttattccaattggt
tcccagagctcaaagcttacaagaagacgctattacttgccaaatgcctctccgtaccaa
ctctggagtaggtcatttgcatctgacaatggagaccaggttgaagctgttgtccctttc
atgggtgaatctgtaactgatggaactcttgctaacttcttgaagaaacctggtgacaga
gttgaggctgatgagcccatagcacagattgaaactgataaggttactatagatgttgct
agtccggaagctggtgttattgaaaagttcattgctagcgaaggtgatactgttactcca
ggcaccaaagttgctatcatatcaaagtctgcggcaccagctgaaacacatgttgctccg
tctgaggattcaaccccaaaagaaacgcctccaaaagctgaggagacaaaaccaaaatta
gaagagaagtcaccaaaagcagaacctcccaagatgcctctgccacccaaaacctcccct
acagaaccacagctccctccaaaagaacgagaacggagggtgccaatgccaaggctcagg
aagcgtattgcaaaccgtttgaaggattcacaaaacacatttgcaatgctgaccacattt
aatgaagttgacatgactaatttgatgaagctgcggtctgattataaggatgagtttgtc
accaagcacggtgtcaaattgggtctgatgtcctgctttgtcaaggctgctgttacagca
cttcaaaaccaaccaattgtcaatgctgtcattgatggtgatgacatcatatacagagac
tatgttgacatcagtgttgctgttggtacttccaagggtcttgtggtgcctgttatccga
gatgctgataacatgaactttgcggacattgagaaagggataaacgcccttgcaaagaag
gctactgagggggcactctcaattgatgagatggcaggaggaacattcaccatctctaac
ggtggtgtttacggaagccttatcagcacacctatcatcaaccccccacagtctgctatt
cttggaatgcactccattgtacaacgccctgtggtcgtggacggcaacattctcgcgagg
ccaatgatgtaccttgcgctgacatatgaccacaggctgatcgacggcagagaagctgtc
tacttcctgcgccgcatcaaggacgtggttgaagacccacggagattgctcctcgacata
taa

DBGET integrated database retrieval system