KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335745Help
Entry
4335745           CDS       T01015                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    4335745
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4335745
   00620 Pyruvate metabolism
    4335745
   00640 Propanoate metabolism
    4335745
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     4335745
Lipid biosynthesis proteins [BR:osa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   4335745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 747 aa AA seqDB search
MAQLHIYASCGCARARAAIPLPAQAQASAAALPWVMSVTSPPLLRRGGWAMGASDHAAVA
AAASGNGKPRARRPSAAAAAVLGEPVAASDDHGLVHPSTDFASQALVSSTQQYQEMYRRS
IDDPAGFWSEIAETFYWKHKWNPDEVCTENLDVTKGPIKIEWFKGGKTNICYNAVDRNVE
AGDGEKIAMYWEGNEPGQDAKLTYSELLNKVCQLANYLKSVGVGKGDAVVIYLPMLMELP
IAMLACARIGAVHSVVFAGFSADALAQRIIDCKPKVVITCNAVKRGKKLIALKDIVDVSL
ADSAKNGVDVGISLTYENQSAMKREDTKWTSGRDVWWQDVVPNFPTKCDVEWVDAEDPLF
LLYTSGSTGKPKGVLHTTGGYMVYSATTFKHAFDYKPSDIYWCTADCGWITGHSYVTYGP
LLNGATVLVYEGAPNYPDPSRCWDVVDKYGVTIFYTAPTLIRALMRDGTEYVTRYSRKSL
RVLGSVGEPINPTAWRWFYDIIGDARCPISDTWWQTETGGFMITPLPGAWPLKPGSATFP
FFGVQPVIVDEKGKEMEGECSGYLCIKKSWPGAFRTLYGDKDRYETTYFKPFAGYYFSGD
GCSRDKDGYHFLTGRVDDVINVSGHRIGTAEVESALVSHPKCAEAAVVGIDHEVKGQGIY
AFVTLVDGVPYSDELRKSLVMTVRSQIGAFAAPDKIHWAPGLPKTRSGKIMRRILRKIAS
RQLDELGDTSTLAEPGVVDQLIALADS
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctgcatatatacgccagctgcggctgcgcacgcgcccgcgctgcgatcccg
cttcccgcgcaggctcaggcatccgctgcggctctaccttgggtgatgtccgtgacttcg
ccgccgctgctccggcgaggagggtgggcgatgggcgcgagcgatcacgccgcggtggcg
gcggcggcgagcggtaacggcaagccgcgggcgaggaggccctccgccgccgcggcggcc
gtgctgggcgagccggtggcggcgtccgacgaccacggcctcgtccaccccagcacggac
ttcgcctcccaggccctcgtctcctccacgcagcagtaccaagaaatgtaccgacgttcg
atcgacgatccggccgggttctggtcggagatcgcggagacgttctactggaagcacaag
tggaaccctgacgaggtctgcaccgagaatctggatgtcaccaaggggccgatcaagatc
gaatggttcaaagggggcaagaccaatatatgctacaatgcggtggaccgcaacgtggag
gctggcgacggcgagaagatagcgatgtactgggaagggaacgagcccggccaggacgcg
aagctcacctactccgagctcctgaacaaggtttgccagctggcaaattacctgaagagc
gtcggcgtcgggaagggtgatgccgtggtgatctacctgccgatgctgatggagctgccc
attgcgatgctcgcgtgtgctcggattggcgctgttcattcggttgtgtttgctggcttc
tctgctgacgcactagcacaaagaatcattgactgcaagcctaaggttgtgattacgtgc
aacgcggtgaaaaggggaaagaaactcatagctctcaaagatatagtagatgtgtcgctg
gctgacagtgcgaagaatggagtcgatgtaggcatttctttgacatacgaaaatcagtcg
gcaatgaagagagaagacacaaaatggacgtcaggcagagacgtttggtggcaggatgtt
gtgcccaattttccaacaaaatgtgatgtggaatgggtagatgcagaggatccattgttt
cttctatatacaagtggtagcacaggaaagccaaagggtgtattgcatacaacgggaggc
tatatggtgtactctgcaacaacatttaagcacgcatttgattacaagccatcagatata
tactggtgcactgcagactgtgggtggattactgggcatagttatgtgacatatggtcct
ctcctgaatggagccacagttcttgtttacgaaggggctccaaactatcctgatcctagt
cgttgttgggacgttgttgacaaatacggggtgacgatattttatactgcaccaacactt
attcgtgcactcatgcgtgatggtaccgagtatgttactcggtattctcgtaaatctctt
cgagttctaggaagcgtaggcgagccaatcaatcccactgcttggagatggttctatgat
attattggtgatgcaagatgcccaatatcagacacttggtggcagactgaaactggtggt
tttatgatcactcctttacctggcgcttggcctctgaaacccggatctgcgacatttcct
ttcttcggtgtacagccagtaatagtagatgagaaagggaaggaaatggaaggagaatgc
agcggatacctttgcataaagaagtcatggcctggggctttccggacactttatggagac
aaggacagatatgaaaccacatacttcaagccatttgctggctattacttctccggtgat
ggttgcagcagggacaaagatggataccattttctgactggacgggttgacgatgttatc
aatgtcagcggccaccggattgggacagcagaggttgagtctgctctggtttcacatcca
aaatgcgccgaggccgctgttgttggaattgaccatgaggttaaaggccagggaatttac
gctttcgtgacattggtggacggtgttccttacagcgatgagctacggaaaagcctcgtt
atgactgttcgcagccagattggggcgttcgcggcgccggacaagatccactgggcgccg
gggctcccgaagacgcggagcggcaagatcatgcggaggatcctgcggaagatcgcgtcc
aggcagctggacgagctcggcgacaccagcacgctcgccgaaccaggcgtcgtcgaccag
ctcatcgcgctcgccgatagctag

DBGET integrated database retrieval system