KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335765Help
Entry
4335765           CDS       T01015                                 

Definition
Os04g0409600
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     4335765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 309 aa AA seqDB search
IIKHVILLSIGLVDXXXXXXXXXXXXXXXXXXXXXXXSFSIPCQVLYIDIDVHHGDGVEE
AFYFTDRVMTVSFHKYGDFFFPGTGDIKDIGEREGKYYAINIPLKDGIDDSGFTRLFKTV
IAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAECVKFVKKFNIPLLVTGGGGYT
KENVARCWAVETGVLLDTELPNEIPDNEYIKYFAPDYTLKVSNVNMDNLNSKSYLSSIKV
QVMESLRAIQHAPGVQMQEVPPDFYIPDIDEDELDPDERVDQHTQDKQIHRDDEYYEGDN
DNDHEDGAR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atcataaaacatgtgatattgctatcaattgggctggtggatnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngagcttctca
ataccatgccaggttctctatattgatatcgatgttcatcacggggatggagttgaagaa
gccttttatttcactgacagggtaatgactgtaagtttccacaagtatggtgattttttc
ttccctggcacaggtgatattaaggatataggagaaagagaaggaaaatattatgccatt
aacattccacttaaagatgggatagatgactccggctttactcgcctttttaaaacagtt
attgccaaagttgttgagacatatctgccaggtgctattgttcttcaatgcggggctgat
tccttggcacgggaccgtctggggtgcttcaatctgtccattgaaggccatgctgaatgt
gtgaagtttgtcaagaaattcaatatccctctactggtgactgggggtggtggatacaca
aaagagaatgtagcacgctgttgggctgttgaaactggtgttcttctagatacggagctc
ccaaatgaaattccagacaatgaatacatcaaatactttgctccagattatacattgaaa
gtatcgaatgtgaacatggacaacttgaatagcaagtcatatctaagttcaatcaaagtg
caagtcatggagagtttgcgggccatacaacatgcgcctggtgttcagatgcaagaggtt
ccaccagatttttatatcccagatattgatgaagatgagctggatcctgatgaacgtgta
gatcagcatacccaagacaagcagattcatcgcgatgacgagtactatgaaggtgacaac
gacaatgatcatgaggacggggcccgttga

DBGET integrated database retrieval system