KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335790Help
Entry
4335790           CDS       T01015                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 2
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    4335790
   00500 Starch and sucrose metabolism
    4335790
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     4335790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4
AA seq 598 aa AA seqDB search
MGVLGSRVAWAWLVQLLLLQQLAGASHVVYDDLELQAAATTADGVPPSIVDSELRTGYHF
QPPKNWINDPNAPMYYKGWYHLFYQYNPKGAVWGNIVWAHSVSRDLINWVALKPAIEPSI
RADKYGCWSGSATMMADGTPVIMYTGVNRPDVNYQVQNVALPRNGSDPLLREWVKPGHNP
VIVPEGGINATQFRDPTTAWRGADGHWRLLVGSLAGQSRGVAYVYRSRDFRRWTRAAQPL
HSAPTGMWECPDFYPVTADGRREGVDTSSAVVDAAASARVKYVLKNSLDLRRYDYYTVGT
YDRKAERYVPDDPAGDEHHIRYDYGNFYASKTFYDPAKRRRILWGWANESDTAADDVAKG
WAGIQAIPRKVWLDPSGKQLLQWPIEEVERLRGKWPVILKDRVVKPGEHVEVTGLQTAQA
DVEVSFEVGSLEAAERLDPAMAYDAQRLCSARGADARGGVGPFGLWVLASAGLEEKTAVF
FRVFRPAARGGGAGKPVVLMCTDPTKSSRNPNMYQPTFAGFVDTDITNGKISLRSLIDRS
VVESFGAGGKACILSRVYPSLAIGKNARLYVFNNGKAEIKVSQLTAWEMKKPVMMNGA
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcttggtagtagggtcgcttgggcatggctggtccagctgctgctgctccag
cagctcgccggagcgtcgcacgtcgtctacgacgacctcgagctgcaggcggctgctacc
acagcggacggcgtgccgccgtccatcgtcgactctgagctccggactgggtatcacttc
cagccacccaagaactggatcaatgatccgaacgcgccgatgtactacaaggggtggtac
catctgttctaccagtacaaccccaagggcgccgtgtgggggaacatcgtgtgggcgcac
tcagtgtcacgtgacctcatcaactgggtggcgctcaagccggccatcgagcccagcatc
agggccgacaagtacggctgctggtcggggtcggcgacgatgatggccgacgggacgccg
gtgatcatgtacaccggcgtcaaccgccccgacgtcaactaccaggtgcagaacgtggcg
ctgccgaggaacgggtcggacccgctgctgcgcgagtgggtgaagcccggccacaacccg
gtgatcgtgcccgagggcggcatcaacgcgacgcagttccgcgacccgaccaccgcgtgg
cgcggggccgacggccactggcggctgctcgtcggcagcctcgcggggcagtcccgcggc
gtggcgtacgtgtaccggagcagggacttccggcggtggacgcgcgcggcgcagccgctg
cactcggcgcccacggggatgtgggagtgcccggacttctacccggtcaccgcggacggc
cgccgcgagggcgtcgacacctcgtccgccgtcgtcgacgccgccgcctcggcgcgcgtc
aagtacgtgctcaagaacagcctcgacctgcgccggtacgactactacaccgtcggaacg
tacgaccggaaggccgagcggtacgtgccggacgaccccgccggcgacgagcaccacatc
cgctacgactacggcaacttctacgcctccaagacgttctacgacccggcgaagcgccgc
cgcatcctctggggatgggccaacgagtccgacaccgccgccgacgacgtggccaagggc
tgggccggaatccaggcgattccgaggaaagtgtggctggacccaagtgggaagcaactg
ttgcagtggccaatcgaggaggtcgagaggctgagagggaagtggccggtcattctcaag
gacagggtggtcaagccaggggaacacgtcgaggtgaccgggctacaaactgcacaggct
gacgtggaggtgagcttcgaggtggggagcctggaggcggcggagcggctggacccggcg
atggcgtacgacgcgcagcggctgtgcagcgcgcggggcgccgacgcgaggggcggcgtg
gggccgttcggcctgtgggtgctcgcgtccgcggggctggaggagaagaccgccgtgttc
ttcagggtgttcaggccggcggcgcgcggcggcggcgccggcaagcccgtcgtgctcatg
tgcaccgaccccaccaagtcatcgcgcaacccgaacatgtaccagccgacgtttgcaggg
ttcgttgacacggacatcaccaacgggaagatatctctgaggagcctgatcgacaggtcg
gttgttgagagcttcggggctggaggaaaggcgtgcatcctgtcgagggtgtacccgtcg
ctggccatcggcaagaacgcgcgcctttacgttttcaataacgggaaggcggagatcaag
gtgtcgcagctcaccgcgtgggagatgaagaagccggtcatgatgaatggagcctaa

DBGET integrated database retrieval system