KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335795Help
Entry
4335795           CDS       T01015                                 

Definition
Os04g0414100
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4335795
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   4335795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 550 aa AA seqDB search
MTRIFVQRGAAGSSSSSSRSGSQTLQQQQQLQATSAVAREEELPPQPHQHPSELTASDNI
TDHLVEDADNSSNSNKPLGLDDPTSESSSSAEERAVMEKPPKDDSSVIDPAFLVEELTGL
QFSDQFEQENLVQSGIGPSQIAGAASHPPPPPAPPAPPPKPSSGNNGLRRMGSGSSNNAR
IGSSRRPVAWPPVAVRSSASGSRPSSPRSLADSEGYNSADEQGPCYASNYYDSERERMFE
HDLRRVRGFEINKMAEDGNCLFRAVADQVYGDPEAYDMARQMCVDYMERERDHFSQFMTE
GFTSYCRRKRRDKVYGNNMEIQAFAEMYNRPIHIYSYSTEPINIFQGSYNTDVPPIRLSY
HHGNHYNSVVDPRGLTVGAGLGFSSLRGTNNVDRDQVKAAIKAQQDQQIENALLAEGRLY
SDLELTEKEIERMVMEASRAEYLKQQQQQLNFRESSTSGAEPSSSAAISGSSRSAGTADR
VGEECFVLPDTVLTRSMQLLLAMGFNYIQVMEAYSIFGEDVDSMIYYLVEMGGTGASAGG
SNRRKGKAAE
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggatcttcgtgcagcgcggggctgccggctcctcgtccagctccagccgctcg
gggtcacagacactgcagcagcagcagcaactgcaggcgacatcagcggttgcccgggag
gaggagctgccgccgcagcctcatcagcatccatcggagctcacggcttcagacaatata
actgaccatctagtggaggatgctgataacagcagtaatagtaataagccattggggcta
gatgatcccacatcagagagttcaagctctgcagaggagagggctgttatggagaaacct
cccaaagacgactccagtgtgatcgatcctgctttcttggtggaggaattaacaggcctc
cagttttctgatcagtttgagcaggaaaatctagtgcagtcaggtattggtccatcacag
attgctggtgcagcatcacacccaccacctccaccagctccaccagccccaccaccgaaa
ccatcgtctggtaataatgggttaaggagaatggggtctggaagctcaaacaatgcacgg
attggatcttcaagaaggccagttgcttggccaccagtggcagttcggtcatctgcttcg
ggttcccgaccttcttcacctagatcacttgctgatagtgaagggtataatagtgcagat
gagcagggcccctgttacgcctctaattattatgattcggaaagggagcgcatgtttgaa
catgacctaagacgagtgagaggatttgaaatcaataagatggctgaagatgggaattgt
ctgtttagagcagttgcagatcaagtttatggtgatccagaagcttatgacatggctagg
cagatgtgtgttgattacatggaaagggaacgtgatcatttctcgcagttcatgacggaa
ggttttacatcatattgtaggagaaaaagaagagataaggtatatgggaacaatatggag
atccaggcatttgctgagatgtacaatcgtccgattcacatatattcctatagtacagag
cccattaacatttttcaaggaagctacaatacagatgtccctccaattaggctaagttac
catcatggtaatcattacaattcggtggttgatcctcgtgggctgacagtaggggcaggc
ctgggatttagttcccttagagggacaaataacgttgacagggatcaggtgaaggctgca
ataaaagcacagcaagatcagcagattgagaatgcacttctggctgaaggacgactatac
tctgatttggagttgacagagaaggaaatagagcggatggtgatggaggcctcacgagca
gagtatctaaagcagcagcaacaacaacttaacttcagagagtcatcaacatcaggggca
gagccatcttcttctgctgcgattagtgggtcttctcggtcagctgggactgccgataga
gttggcgaggagtgcttcgttctcccggacaccgtgctaacccgcagcatgcagctcctc
ctggcaatgggcttcaactacatccaggtcatggaagcctatagcatatttggcgaggac
gtcgactcaatgatctactaccttgtggagatgggaggcaccggagcctctgcaggtggt
agcaatcgcaggaaaggaaaagctgctgagtga

DBGET integrated database retrieval system