KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335881Help
Entry
4335881           CDS       T01015                                 

Definition
Os04g0432500
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4335881
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4335881
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4335881
  Exosomal proteins of colorectal cancer cells
   4335881
  Exosomal proteins of bladder cancer cells
   4335881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 423 aa AA seqDB search
MAATTTRPLPLLLLLLLPPLLLLLLSFHAAAAAAAEEFPRDGRVIELDESSFEAALGAID
YLFVDFYAPWCGHCKRLAPELDEAAPVLAGLSEPIIVAKVNADKYRKLGSKYGVDGFPTL
MLFIHGVPIEYTGSRKADLLVRNLNKFVAPDVSILESDSAIKSFVENAGTSFPMFIGFGV
NESLIAGYGGKYKKRAWFAVAKDFSEDFMVTYDFDKVPALVSLHPKYKEQSVFYGPFEGS
FLEDFIRQSLLPLTVPINTETLKMLDDDDRKVVLAILEDDSDETSSQLVKVLRSAANANR
DLVFGYVGIKQWDEFVETFDISKSSQLPKLIVWDRNEEYEVVEGSEKLEEGDQASQISQF
LEGYRAGRTTKKKVSGPSFMGFLNSLVSLNSLYILICVFALLGVMIYFTGQDDTPQVRRA
HEE
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacgacgacgagacccctccccctcctcctcctgctgcttctgcctcctctc
ctcctcctgctgctctccttccacgccgccgccgccgccgccgccgaggagttcccgcgc
gacgggcgggtgatagagctggacgagagcagcttcgaggcggcgctgggcgccatcgac
tacctcttcgtcgacttctacgcgccatggtgcggccactgcaagcgcctcgcccccgag
ttagatgaagctgcaccggtgttggcaggactgagtgagcccatcatagttgccaaagta
aatgctgacaagtacaggaagcttggatcgaaatatggagtggacgggttccctacactg
atgctttttatccacggggtccccatcgaatacactggttcaagaaaagctgacttgctt
gtccgcaatcttaataagtttgttgcacctgatgtttctattcttgagtcggactctgcg
atcaagagctttgttgagaatgctggcacgagctttccaatgttcattgggtttggggtg
aatgagtcgttgattgctggttatggagggaaatacaagaaaagagcatggtttgctgtt
gcaaaagatttttctgaggacttcatggtcacttatgattttgataaggttcctgcattg
gtttcacttcatccaaagtacaaagaacaaagtgtattttatggcccatttgaaggaagt
ttcttggaagattttatacggcaatccctgcttcctttgactgtccccatcaacacagag
acactcaaaatgttggatgatgatgacagaaaagttgttcttgcaattttggaggatgat
tcagatgaaacttcttcacagttggtaaaagttttgaggtctgctgccaatgcaaaccgt
gacttggtgtttgggtatgtcggaatcaaacaatgggatgagtttgtcgagacttttgat
atttccaagagctcacagctgccaaagctaatcgtctgggatagaaatgaggagtatgaa
gtggtggaaggctcagagaagttagaggaaggtgatcaagcttctcaaataagccaattc
cttgagggatatagagcaggaagaacaacaaagaagaaagtcagtggcccatctttcatg
ggtttcctgaactctcttgtcagcctgaactcgctatacattcttatatgtgtcttcgct
cttcttggtgtcatgatatactttactgggcaagatgatactcctcaggtaagacgagct
catgaagagtga

DBGET integrated database retrieval system