KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335906Help
Entry
4335906           CDS       T01015                                 

Definition
Os04g0436300
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4335906
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     4335906
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4335906
  Exosomal proteins of colorectal cancer cells
   4335906
  Exosomal proteins of bladder cancer cells
   4335906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 517 aa AA seqDB search
MAVNLVLSFALAILISSSPTAVGVDATEELKEAVLTLDAGNFSEVVAKHPFIVVKFYAPW
CGHCKQLAPEYEKAASILRKNELPVVLAKVDAYNERNKELKDKYGVYSYPTIKIMKNGGS
DVRGYGGPREADGIVEYLKRQVGPASLKLESAEEAAHSVVDKGVILVGVFPEFAGMEYEN
FMVVAEKMRADYDFFHTSDASILPRGDQSVKGPIVRLFKPFDELFVDSEDFGKDALEKFI
EVSGFPMVVTYDADPTNHKFLERYYSTPSSKAMLFVSFGDDRIESFKSQIHEAARKFSGN
NISFLIGDVADADRVFQYFGLRESDVPLLFVIASTGKYLNPTMDPDQIIPWLKQYIVEYG
NLTPYVKSEPIPKVNDQPVKVVVADNIDDIVFNSGKNVLLEFYAPWCGHCRKFALILEEI
AVSLQDDQDIVIAKMDGTVNDIPTDFTVEGYPTIYFYSSSGNLLSYDGARTAEEIISFIN
ENRGPKAGAAAAVDEKTQIDAVEEEVTSSSEPVKDEL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaacctggtgctgtcttttgcccttgccattctgatatcctccagccctacc
gcggttggtgtggatgccaccgaggagctgaaggaggcggtcctaacgctggatgcgggc
aacttctcggaggtggtggccaagcacccgttcattgtcgtcaagttctatgccccatgg
tgtggtcactgcaagcaactcgccccagagtacgaaaaggcagcctccattctgaggaag
aacgagctgccagtggtactcgcgaaggtggacgcatacaacgagaggaacaaagagctg
aaggataagtatggggtgtattcatacccaacaataaagatcatgaagaatggggggagc
gacgtgcgtggctacggtggcccaagggaggccgatggcatcgtggagtaccttaagagg
caggtcggcccagcatccctcaagcttgaatcagcagaagaggcggcccattccgtcgtc
gacaagggggtgatccttgtgggagttttccctgagtttgctggtatggaatatgaaaat
ttcatggttgtggcagagaaaatgcgagcagattatgattttttccacacgtctgatgca
agcattttgccacgtggtgatcagagtgtcaaaggccccattgtccgtctctttaagccg
tttgatgagctgtttgttgattcggaggattttggtaaggacgcacttgagaagtttatc
gaggtatctggtttcccaatggttgttacctacgatgctgatccaaccaaccataagttt
cttgaaagatactatagcactcctagttctaaagcaatgcttttcgtgagcttcggtgat
gacagaatcgagtccttcaagagccagattcatgaagcggccaggaaattcagtggtaat
aacataagttttttaattggtgatgttgcagacgctgatcgtgtcttccagtactttggg
ctcagagaaagtgatgtgcccctccttttcgtgatagcatctactggaaaatatctcaat
ccaacaatggatcctgatcagatcataccctggctgaagcagtacatagttgagtatggc
aacttgacaccatacgttaagtcagagcctatccctaaggtgaatgaccaacctgttaag
gttgttgtggccgacaatatagatgacattgttttcaactctggcaaaaatgttttgctt
gagttctatgcaccttggtgtggccattgccgcaagtttgccctgatcctggaggaaatt
gcagtgtcattgcaagatgaccaagatatagtgatagcaaagatggatggaactgtgaac
gatataccaacagacttcacggttgagggatatccaactatctacttctattcatcaagt
gggaaccttttgtcgtacgacggtgcaaggacagctgaggagatcatcagttttatcaac
gagaacaggggaccgaaagctggtgcagctgctgcagtggatgagaaaacccagattgat
gctgtggaagaggaggtaacatcatcatcagagcctgttaaagatgaactctga

DBGET integrated database retrieval system