KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336039Help
Entry
4336039           CDS       T01015                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4336039
   00052 Galactose metabolism
    4336039
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     4336039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 438 aa AA seqDB search
MKGSDQSKRSHASTRAAQVSVRNQAGPVPPRTNSSEIAAGIRLYLHLYQETIENELHASL
SSRPVSCPRRIALLTMAGARLSLAFLCFVVVVVASALAGGAGARKTVGEYVLRKGDFSVK
ITNWGATMMSVVLPDSKGNLADVVLGLDTIAEYVNDTNYFGPVTGRVGQRIARGRFVLDG
KVYHTYINDGRNAIHGGHRGFSKVIWTVKEYVGGGDSPYITLYYRSFDGEQGFPGDLDAY
VTYQLSSPYVLALRMNATALNKATPVNFLQHTYWNLGGQGRGDVLGHTLQLSASRYTPLD
EELLPSSGVVAPVAGTPYDFRHPTPIGARIRQVMGGRIAGYDINYVIDGEGMRKVAAARD
GASGRALELWANQPAMQLYTGNWLNNIKGKGGKVYQQYGGFCLETQGYVDAVNHPEFPSM
TVRPGQVYRHDMAFKFSF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatcagatcaatcaaaaagatcacacgctagcacgcgcgcagcgcaggtgtct
gtccgtaaccaggctggtccggtcccgcctcgaacaaactcgtccgagatcgcggccggt
atccgcctatatctacatctatatcaggagaccatcgagaatgagttgcatgcatccctc
tcctctcgtcctgtgagttgcccaagacgaatcgctttgctcacaatggctggagctcgg
ttgtctctcgcgttcctgtgctttgtggtggtggtggtggcctccgcgctcgccggcggc
gccggtgcgaggaagacggtcggcgagtacgtgctcaggaagggggacttctccgtgaag
atcaccaactggggagcaaccatgatgtcggtcgtcctccctgattccaaagggaatttg
gctgatgttgtgcttggcctagacaccattgctgagtacgtgaacgacactaattacttc
gggccggttaccggacgggtcgggcagaggatagccagggggcggttcgttctcgacggg
aaggtgtatcacacgtacatcaacgacggcaggaacgcgattcacggtggacacagaggg
ttcagcaaagtcatatggacggtgaaggagtacgtcggcggcggcgactcgccgtacatc
accttgtactaccgcagcttcgacggagagcaaggtttccccggggacctggacgcgtac
gtgacgtaccagctgtcgagcccgtacgtgctggcgctgcgcatgaacgcgacggcgctg
aacaaggcgacgccggtgaacttcctgcagcacacgtactggaacctcggcgggcagggc
cgcggcgacgtgctggggcacacgctgcagctgtcggcatcccggtacaccccgctggac
gaggagctcctcccgtcgtcgggcgtcgtcgcgcccgtcgccggcacgccctacgacttc
cggcaccccaccccgatcggcgcgcgcatccggcaggtgatgggcgggcgcatcgccggg
tacgacatcaactacgtgatcgacggcgagggcatgcggaaggtggccgcggcgcgggac
ggcgcgtcgggccgcgcgctggagctgtgggcgaaccagccggccatgcagctgtacacc
ggcaactggctgaacaacatcaagggcaagggcggcaaggtgtaccagcagtacggcggg
ttctgcctggagacgcaggggtacgtggacgccgtgaaccacccggagttcccctccatg
acggtcaggcccggccaggtgtacaggcacgacatggccttcaagttctccttctag

DBGET integrated database retrieval system