KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336102Help
Entry
4336102           CDS       T01015                                 

Definition
Os04g0467700
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    4336102
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4336102
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     4336102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 246 aa AA seqDB search
APPVRDFVGVLKASFDRTGLPALIAEVKKASPSRGVLREDFEPVQIAQTYEKNGAACLSV
LTDAKYFQGSFDYLDAIRNAGVQCPLLCKEFIVDAWQLYYARLKGADAVLLIAAVLPDLD
IKYMLKICKILGMAALVEVHDEREMDRVLGIDGVQLIGINNRNLETFQVDISNTKNLLEG
ERGQTIAQKGIIVVGESGLFTPDHISFVQNAGVKAVLVGESLIKQEDPGKAIAGLFGKDI
SPVSAA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gctcctccggtgagggatttcgttggggtgttgaaggcgtcttttgatcggactggtctg
cctgctctgattgcagaggtcaagaaggcttcaccgagccgcggtgtcctgagggaggac
ttcgagccggttcagatcgcccaaacatatgagaaaaatggagcagcatgcttaagtgtt
ctcacagatgcaaaatactttcagggaagttttgactatttggatgctatacgcaatgct
ggagtacagtgtcctctgctgtgcaaagagttcattgttgatgcctggcaactttactat
gcgcgtttgaagggagcagatgctgttcttctgattgctgctgtcttacctgatcttgat
atcaagtatatgttgaaaatatgcaaaatacttggcatggctgctttagttgaggtgcat
gatgaaagggaaatggaccgtgtgttagggatagatggtgtccagctcatcggcatcaat
aaccgtaacctcgagacttttcaagttgatatttcaaacactaaaaatcttcttgagggt
gaaagaggacaaactatagctcagaaaggcataattgttgtaggggaatcagggctgttc
acaccagaccatatttcattcgttcagaatgctggggttaaagctgttctcgttggggag
tctctcatcaagcaggaggatcctggcaaagcaatcgctgggcttttcggcaaagacatc
tcacctgtgagtgctgcgtaa

DBGET integrated database retrieval system