KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336202Help
Entry
4336202           CDS       T01015                                 

Definition
Os04g0483500
Orthology
K10251  
17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Fatty acid elongation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    4336202
  Lipid metabolism
   00062 Fatty acid elongation
    4336202
   01040 Biosynthesis of unsaturated fatty acids
    4336202
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     4336202
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     4336202
Lipid biosynthesis proteins [BR:osa01004]
 Fatty acid synthase
  Component type
   4336202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 318 aa AA seqDB search
MDALSAQPAWALALAGVGLMVAATASARLARWLYAAFLRPGKPLRRRYGEWAVVTGATDG
IGRALAFRFAGAGMSLVLVGRSPDKLAAVSGEIRGKHPRAEVRTFVLDFAAEGLAAKVAA
LGDSIRGLDVGVLVNSAGMSYPYARYFHEVDEELMRNLIRLNVEALTRVTHAVLPGMVER
KRGAIVNIGSGASSILPSYPLYSVYAATKAYVDQFSRCLYVEYKNKGIDVQCQVPLYAAT
KMASIKKASFFAPSPETYARAAVRYIGYEPRCTPYWPHAVLWFLISAFPEPIVDRLLLNM
SVGIRKRGMAKDARKKTQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgctgtccgcgcagccggcgtgggcgctggcgctggccggggtgggcctcatg
gtggccgcgaccgcctcggcgcgcctcgcgcggtggctctacgcggcgttcctccgcccg
gggaagcccctgcgccgccggtacggcgagtgggcggtcgtcacgggcgccacggacggc
atcggccgcgcgctcgcgttccgcttcgcgggcgccgggatgagcctcgtgctcgtgggc
cgcagccccgacaagctggccgcggtctccggggagatcagggggaagcaccccagggcc
gaggtccgcaccttcgtgctcgacttcgccgccgagggcctcgccgccaaggtggccgcg
ctcggggactccatccgcgggctcgacgtcggcgtgctcgtcaacagcgccggcatgtcg
tacccgtacgcgcgctacttccacgaggtggacgaggagctgatgcgcaacctcatccgc
ctcaacgtcgaggcgctcacccgggtcacccacgccgtgctcccaggcatggtggagcgc
aagcgcggcgccatcgtcaacatcggctccggcgcctcctccatcctgccgtcctacccg
ctctacagcgtctacgccgccaccaaggcgtatgttgatcaattctcgagatgcctctat
gttgagtacaagaacaaaggcatcgatgtgcaatgccaggtacccctgtacgcggcgacg
aagatggcgtccatcaagaaggcgtccttcttcgcgccgtcgccggagacgtacgcccgc
gccgccgtgcgctacatcgggtacgagccgaggtgcacgccctactggccgcacgcggtg
ctgtggttcctcatctccgcgttcccggagcccatcgtggacaggctcctcctcaacatg
tccgtcggcatccgcaagaggggcatggccaaggacgccaggaagaagacgcagtga

DBGET integrated database retrieval system