KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336205Help
Entry
4336205           CDS       T01015                                 

Gene name
ELP3, OJ000223_09.4
Definition
(RefSeq) elongator complex protein 3
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     4336205 (ELP3)
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    4336205 (ELP3)
Chromosome [BR:osa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    4336205 (ELP3)
   HAT complexes
    Elongator complex
     4336205 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 573 aa AA seqDB search
MATAVAAAGGGGGGEQPRRRKPAPGRGGVVLPAGLSEEEARVRAIAEIVSAMGELSRRGE
DVDLNALKSAACRRYGLARAPKLVEMIAAVPEADRAALLPRLRAKPVRTASGIAVVAVMS
KPHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQ
LKRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVCYSEHGAVK
CIGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLA
KDAGFKVVAHMMPDLPNVGVERDLESFREFFENPAFRADGLKIYPTLVIRGTGLYELWKT
GRYRNYPPELLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMEDL
GLKCRDVRTREAGIQDIHHKIRPDEVELVRRDYAANEGWETFLSYEDTQQDILIGLLRLR
KCGRNVTCPELVGRCSIVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARKEHR
SKKIAVISGVGTRHYYRKLGYELEGPYMVKCLV
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgtagccgccgccggcggtggcggcggcggcgagcagccgcgcaggagg
aagccggcgccggggagagggggagtggtgctccccgcggggctgtcggaggaggaggcg
cgggtgcgggccatcgcggagatcgtgtcggcgatgggggagctctcgcggcgaggggag
gacgtggacctgaacgcgctcaagtcggccgcgtgccggaggtacgggctggcgcgggcg
ccgaagctggtggagatgatcgcggcggtgccggaggccgaccgcgccgcgctgctccca
aggctgcgcgccaagcccgtgcgcacggcgtcgggcattgccgtggtcgccgtgatgtcg
aagccgcaccggtgcccccacatcgccaccacggggaacatctgcgtgtactgccccgga
ggccccgactccgacttcgagtacagcacccagtcctacaccggctacgagcccaccagc
atgcgcgccattcgagcaaggtacaatccatatgtgcaggccagaagcaggatagatcag
ctcaaaaggctaggccatagtgtagacaaggtcgaattcatattgatgggtggaactttc
atgtcattaccagctgattatcgggattatttcattagaaatcttcatgatgccttatcg
ggacacacttctgctaatgttgaagaggctgtttgttattcagaacatggtgcagtcaaa
tgtattggcatgacaattgagacgagacctgattattgcttggggcctcatttgcgccag
atgctatcttatggttgtacccgcttagaaattggtgttcagagcacatacgaggatgtt
gcacgtgacacaaacagaggtcacactgtagctgctgttgctgattgcttttgtttggct
aaagatgctggttttaaggtggtcgcccacatgatgccagatttacctaatgttggagtt
gaaagagatctggaaagtttccgagaattttttgaaaatccagcattccgagctgatggt
ctaaagatttatccaactcttgtgattcgtggaactggcctttatgagctctggaaaact
ggcagataccgaaactatccacctgaacttctggtggatattgttgcaagaattctatcc
atggtaccaccttggacacgagtttaccgtgtacaaagagatatccctatgcctcttgtt
acttctggtgttgaaaaaggtaatcttcgtgagcttgctttggctcgaatggaagattta
ggcttgaagtgccgagatgttagaactcgtgaggcgggaattcaggatatccatcacaaa
attagacctgacgaagtagagcttgttaggcgtgactatgctgcaaatgagggctgggag
acctttctctcatacgaggatacacagcaggatatccttattggtctgctgcgattgcga
aaatgtggccgcaatgttacatgccctgagctagtagggaggtgttcaattgtccgtgaa
cttcatgtatatggaactgcagtccctgtacatggtcgtgatgcagacaaactacaacac
cagggttatggtactcttttgatggaagaagcagaaagaattgctcgcaaggagcatcgt
tcaaagaaaatcgctgttatatcaggagttgggactcgccactactaccgtaaactgggt
tatgaacttgaggggccttacatggtcaaatgtctggtctaa

DBGET integrated database retrieval system