KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336627Help
Entry
4336627           CDS       T01015                                 

Definition
Os04g0556300
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    4336627
  Metabolism of other amino acids
   00480 Glutathione metabolism
    4336627
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     4336627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 168 aa AA seqDB search
MAAAPSATSVHDFTVKDASGKDVNLSTYKGKVLLIVNVASQCGLTNSNYTELSQLYEKYK
VQGFEILAFPCNQFGGQEPGSNEEIVQFACTRFKAEYPIFDKVDVNGNNAAPLYKYLKSN
KGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcgccgtccgccacctccgtccacgacttcaccgtcaaggatgcaagcgga
aaagacgtgaacctgagcacctacaaggggaaggttctcctcatcgttaacgtcgcatcc
caatgtggcttaactaactccaactacactgagctgagccagctgtatgagaagtacaag
gtccaaggctttgagatattggctttcccgtgcaatcagtttggagggcaggaacccggc
tccaatgaggagattgtccagtttgcttgcactcgcttcaaggctgagtatcccattttt
gacaaggttgatgtcaacggtaacaatgctgcacccctgtacaagtatctgaagtctaac
aaaggtgggcttttcggtgatagcatcaagtggaacttctccaaattcttggttgacaag
gagggtcgcgtggtggatcgctatgcgcccaccacctcccctcttagtattgagaaggat
atcaagaagctgcttgggagctcttaa

DBGET integrated database retrieval system