KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337205Help
Entry
4337205           CDS       T01015                                 

Definition
Os04g0647300
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 591 aa AA seqDB search
STPPSPHRSHSHSRAHRLIPHIHRPDDHPVRAAAVPAPRRVPPHHALHSASLQPAALRVT
ARSARPEIRREHSRAPPLLPLLLPHLLLVPHSTPALSLRRRLLPHQRRLQRLRLNIRRPP
DRRRRRPRRALLRGVRGSGLRSDLRPRRRPRQVLLPPPPSASASPSPSPAAPRKRRRVEY
RAWAPDPAEFALISSADPTTSASAAAPAGLRGLNNLGNTCFMNSVLQALLHAPPLRNYFL
GDRHNRYLCPRQTPMRRRSAEANDKAACLACDLDEIYSAAFSGERTPYSPAKFLYSWWQH
ASNLASYEQQDAHEFFISILDHIHENIKDDQHKSLAQGHGDCCIAHRVFSGILRSDVTCT
HCGFTSTTFEPCMDISLDLDAGYNNSLGVANPKVHVRNGERSSGGTNTKVSTLMRCLERF
TRAERLDAEQKFFCERCKERQESLKQMSIRRLPLVSCFHIKRFEHSSVKKMSRKVDHCLQ
FPFSLDMAPYLSSSILRSRFGNRIFPSEASDADSVSEFSSEFEIFAVIMHSGKLEAGHYV
TYLRLNNHWYKCDDAWVTRVEEHTVRTSQAYMLFYVQKTLYYKACERATAV
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
tccacccccccatccccgcaccgctcgcactcccactcccgcgcccaccgcctcatcccc
cacattcaccgccccgatgaccaccccgtccgcgccgccgccgtgcccgcacctcgccgc
gtaccgccacaccacgcgctccactccgcttcactccagccagctgcactccgcgtcaca
gcccgctcggcacgccccgagatccgccgcgagcactcgcgagctcccccgctgctcccc
ctgctcctcccccacctcctcctcgtcccgcactctacgcctgcactctcactgcgccgc
cgtcttctgccccaccaacgccgcctccaacgcctccgcctcaacatccggcggccacca
gatcgccgtcgacgtcgaccgcgccgagctcttctgcggggcgtgcggggatcaggtcta
cgatccgatcttcgaccacgccgtcgtcctcgccaagtcctcctccctcctcccccatcg
gcatccgcttccccctccccttcccccgccgcgccccgcaagcgccgccgcgtcgagtac
cgcgcctgggcaccagatccggccgaattcgcgctcatcagctccgccgatcccaccacc
tccgcatccgccgccgcgcccgcggggctccgcgggctcaacaacctaggcaacacgtgc
ttcatgaactccgtgctccaggctctgctacacgcgccgccgctccggaactacttcctc
ggcgatcggcacaaccgctacctctgcccgcgccagacgcccatgaggcgccgttccgcc
gaggcaaacgacaaggcggcgtgcctggcgtgcgatctcgacgagatctactccgccgcc
ttttccggggagcgcacgccctacagccccgccaaattcctctatagctggtggcagcat
gcatcaaatcttgcgagctacgagcaacaggatgcacatgaattttttatctccatcctt
gaccatatccatgaaaatataaaggatgatcaacacaaatcacttgcccaaggccatgga
gattgttgcattgcacacagggtattttctggcatcttgagatcagatgtcacctgcaca
cattgtgggttcacatcaacaacttttgaaccctgtatggacatctctctagacttggat
gctggatataacaattctcttggtgttgcaaacccaaaggtacatgtgcggaatggagag
cgaagctcaggtggcactaataccaaggtatcaacactcatgagatgtttggagcggttt
acaagggctgagcggttggatgctgaacagaagttcttctgtgaacgttgcaaggagagg
caagagtccctgaagcaaatgtccattcggaggcttccattggtttcatgctttcatatt
aagaggtttgagcattcatcagttaagaaaatgtcaaggaaggttgatcactgtttacag
tttcctttttctcttgacatggcgccatatctatcgtcctctatactcagaagcagattt
gggaaccgtatatttccatcagaagctagtgatgcagattcagtttctgaattttcatca
gaatttgaaatatttgcggtgatcatgcatagtggtaagctagaagctggccattatgtg
acatatctcaggttaaacaatcactggtacaaatgtgatgatgcctgggtaaccagagtt
gaagagcatactgtcagaacctctcaggcatacatgctcttctatgtgcagaagacactt
tactacaaagcttgtgaaagagcaactgctgtctga

DBGET integrated database retrieval system