KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337205Help
Entry
4337205           CDS       T01015                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 22
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     4337205
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   4337205
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     4337205
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    4337205
Chromosome [BR:osa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     4337205
    SLIK complex
     4337205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 565 aa AA seqDB search
MTTPSAPPPCPHLAAYRHTTRSTPLHSSQLHSASQPARHAPRSAASTRELPRCSPCSSPT
SSSSRTLRLHSHCAAVFCPTNAASNASASTSGGHQIAVDVDRAELFCGACGDQVYDPDFD
HAVVLAKSSSLPPSASASPSPSPAAPRKRRRVEYRAWAPDPAEFALISSADPTTSASAAA
PAGLRGLNNLGNTCFMNSVLQALLHAPPLRNYFLGDRHNRYLCPRQTPMRRRSAEANDKA
ACLACDLDEIYSAAFSGERTPYSPAKFLYSWWQHASNLASYEQQDAHEFFISILDHIHEN
IKDDQHKSLAQGHGDCCIAHRVFSGILRSDVTCTHCGFTSTTFEPCMDISLDLDAGYNNS
LGVANPKVHVRNGERSSGGTNTKVSTLMRCLERFTRAERLDAEQKFFCERCKERQESLKQ
MSIRRLPLVSCFHIKRFEHSSVKKMSRKVDHCLQFPFSLDMAPYLSSSILRSRFGNRIFP
SEASDADSVSEFSSEFEIFAVIMHSGKLEAGHYVTYLRLNNHWYKCDDAWVTRVEEHTVR
TSQAYMLFYVQKTLYYKACERATAV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccgtccgcgccgccgccgtgcccgcacctcgccgcgtaccgccacaccacg
cgctccactccgcttcactccagccagctgcactccgcgtcacagcccgctcggcacgcc
ccgagatccgccgcgagcactcgcgagctcccccgctgctccccctgctcctcccccacc
tcctcctcgtcccgcactctacgcctgcactctcactgcgccgccgtcttctgccccacc
aacgccgcctccaacgcctccgcctcaacatccggcggccaccagatcgccgtcgacgtc
gaccgcgccgagctcttctgcggggcgtgcggggatcaggtctacgatccggacttcgac
cacgccgtcgtcctcgccaagtcctcctccctccccccatcggcatccgcttccccctcc
ccttcccccgccgcgccccgcaagcgccgccgcgtcgagtaccgcgcctgggcaccagat
ccggccgaattcgcgctcatcagctccgccgatcccaccacctccgcatccgccgccgcg
cccgcggggctccgcgggctcaacaacctaggcaacacgtgcttcatgaactccgtgctc
caggctctgctacacgcgccgccgctccggaactacttcctcggcgatcggcacaaccgc
tacctctgcccgcgccagacgcccatgaggcgccgttccgccgaggcaaacgacaaggcg
gcgtgcctggcgtgcgatctcgacgagatctactccgccgccttttccggggagcgcacg
ccctacagccccgccaaattcctctatagctggtggcagcatgcatcaaatcttgcgagc
tacgagcaacaggatgcacatgaattttttatctccatccttgaccatatccatgaaaat
ataaaggatgatcaacacaaatcacttgcccaaggccatggagattgttgcattgcacac
agggtattttctggcatcttgagatcagatgtcacctgcacacattgtgggttcacatca
acaacttttgaaccctgtatggacatctctctagacttggatgctggatataacaattct
cttggtgttgcaaacccaaaggtacatgtgcggaatggagagcgaagctcaggtggcact
aataccaaggtatcaacactcatgagatgtttggagcggtttacaagggctgagcggttg
gatgctgaacagaagttcttctgtgaacgttgcaaggagaggcaagagtccctgaagcaa
atgtccattcggaggcttccattggtttcatgctttcatattaagaggtttgagcattca
tcagttaagaaaatgtcaaggaaggttgatcactgtttacagtttcctttttctcttgac
atggcgccatatctatcgtcctctatactcagaagcagatttgggaaccgtatatttcca
tcagaagctagtgatgcagattcagtttctgaattttcatcagaatttgaaatatttgcg
gtgatcatgcatagtggtaagctagaagctggccattatgtgacatatctcaggttaaac
aatcactggtacaaatgtgatgatgcctgggtaaccagagttgaagagcatactgtcaga
acctctcaggcatacatgctcttctatgtgcagaagacactttactacaaagcttgtgaa
agagcaactgctgtctga

DBGET integrated database retrieval system