KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337206Help
Entry
4337206           CDS       T01015                                 

Definition
Os04g0647800
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:osa00561]
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:osa04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 529 aa AA seqDB search
MAEEVYVASIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVKIC
MAKALDKAAADGHNMDVGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICRRL
ESDLSGGRTHFVETCGLAISTYFSALKVLWLIENVDAVKNAVRAGDALFGTIDTWLIWNL
TGGIGGTDRDGNKVFGHHVTDCSNASRTMLMNLKALDWDKPTLETLGIPAEILPKIISNS
ERIGVVANGFPLAGVPIAGCLGDQHAAMLGQLCQKGEAKSTYGTGAFILLNTGEEPTQSS
HGLLSTIAYKLGPSAPTNYALEGSIAIAGAAVQWLRDSLGIISTAADIEKLADTVQDSGG
IYFVPAFNGLFAPWWRDDARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGE
AGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGV
WSKEQIFAGLHKENTRVFRPKLDEAHRRKRADSWYKAVSRSFDLADLSL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggaggtgtatgtcgcgtcgatcgaccagggcacgacgagcacgcggttcatc
gtctacgaccgccacgccaagcccgtcgcgtcgcatcagctcgagttcaagcagcactac
ccggaggctggatgggttgagcatgatcctatggagattatggagagtgtgaagatatgc
atggcgaaggcacttgacaaagctgcagctgatggtcataatatggatgttggactgaag
gccattggtattacaaatcagagggaaaccactgttatgtggagcaaatccacaggcctt
cctctatacaatgccattgtatggatggatgctcgcacaagccccatttgcaggagattg
gaaagtgatctttctggtggtagaacccactttgtcgagacatgtggattggcaatcagt
acctatttcagtgctttgaaggtgttatggttgatcgaaaatgtggatgccgtcaagaat
gcagtccgagctggtgatgccttatttggcacaattgacacctggttaatctggaacctc
acaggaggcattggcgggacagatcgtgatggaaataaagtatttgggcaccatgtcaca
gactgctccaatgcatctcgcacaatgcttatgaacctgaaggcacttgactgggacaaa
ccaacacttgagacgttaggaattcctgctgagatattgcccaaaattatcagtaactcg
gagagaattggtgtggttgccaatgggtttcccttggcgggcgtccctattgctgggtgc
ctaggagaccagcatgctgcaatgcttgggcagctgtgccagaaaggtgaagccaaaagc
acctacggaactggtgccttcattcttctcaacacaggggaggagcctacccaatcctcc
catggtcttcttagcacgattgcttataagcttggcccaagcgcacccactaattatgct
ctagaaggctccatcgcaattgctggtgccgcagttcagtggttgagagacagccttgga
atcattagcacagcagctgatattgaaaagttggctgatactgtgcaggattcaggtgga
atatactttgttccagcattcaatgggttgtttgcaccatggtggagggatgatgcaaga
ggcatatgtataggaatcacacggttcactaacaaggggcacattgctcgagcagtgctc
gagagtatgtgctttcaggtgaatgatgtcctcagctccatgcacaaggatgctggggag
gcaggagaagtgaagagtgcagaaggggagttcctgctgcgcgttgatggtggtgctact
gtcaacaatcttctcatgcagatccaggctgatttattgggtagccctgttgtcagacct
gctgacatcgagacaactgcccttggagctgcgtatgcagctggattagctgttggagtc
tggtcgaaggaacaaattttcgctggtttgcacaaggagaacaccagagtcttccgcccg
aaattggatgaggcccacaggaggaagagagcagactcctggtacaaggccgtttcaaga
tcatttgatttggctgacctttctctttag

DBGET integrated database retrieval system