KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337206Help
Entry
4337206           CDS       T01015                                 

Definition
Os04g0647800
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    4337206
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    4337206
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     4337206
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4337206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 529 aa AA seqDB search
MAEEVYVASIDQGTTSTRFIVYDRHAKPVASHQLEFKQHYPEAGWVEHDPMEIMESVKIC
MAKALDKAAADGHNMDVGLKAIGITNQRETTVMWSKSTGLPLYNAIVWMDARTSPICRRL
ESDLSGGRTHFVETCGLAISTYFSALKVLWLIENVDAVKNAVRAGDALFGTIDTWLIWNL
TGGIGGTDRDGNKVFGHHVTDCSNASRTMLMNLKALDWDKPTLETLGIPAEILPKIISNS
ERIGVVANGFPLAGVPIAGCLGDQHAAMLGQLCQKGEAKSTYGTGAFILLNTGEEPTQSS
HGLLSTIAYKLGPSAPTNYALEGSIAIAGAAVQWLRDSLGIISTAADIEKLADTVQDSGG
IYFVPAFNGLFAPWWRDDARGICIGITRFTNKGHIARAVLESMCFQVNDVLSSMHKDAGE
AGEVKSAEGEFLLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAVGV
WSKEQIFAGLHKENTRVFRPKLDEAHRRKRADSWYKAVSRSFDLADLSL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggaggtgtatgtcgcgtcgatcgaccagggcacgacgagcacgcggttcatc
gtctacgaccgccacgccaagcccgtcgcgtcgcatcagctcgagttcaagcagcactac
ccggaggctggatgggttgagcatgatcctatggagattatggagagtgtgaagatatgc
atggcgaaggcacttgacaaagctgcagctgatggtcataatatggatgttggactgaag
gccattggtattacaaatcagagggaaaccactgttatgtggagcaaatccacaggcctt
cctctatacaatgccattgtatggatggatgctcgcacaagccccatttgcaggagattg
gaaagtgatctttctggtggtagaacccactttgtcgagacatgtggattggcaatcagt
acctatttcagtgctttgaaggtgttatggttgatcgaaaatgtggatgccgtcaagaat
gcagtccgagctggtgatgccttatttggcacaattgacacctggttaatctggaacctc
acaggaggcattggcgggacagatcgtgatggaaataaagtatttgggcaccatgtcaca
gactgctccaatgcatctcgcacaatgcttatgaacctgaaggcacttgactgggacaaa
ccaacacttgagacgttaggaattcctgctgagatattgcccaaaattatcagtaactcg
gagagaattggtgtggttgccaatgggtttcccttggcgggcgtccctattgctgggtgc
ctaggagaccagcatgctgcaatgcttgggcagctgtgccagaaaggtgaagccaaaagc
acctacggaactggtgccttcattcttctcaacacaggggaggagcctacccaatcctcc
catggtcttcttagcacgattgcttataagcttggcccaagcgcacccactaattatgct
ctagaaggctccatcgcaattgctggtgccgcagttcagtggttgagagacagccttgga
atcattagcacagcagctgatattgaaaagttggctgatactgtgcaggattcaggtgga
atatactttgttccagcattcaatgggttgtttgcaccatggtggagggatgatgcaaga
ggcatatgtataggaatcacacggttcactaacaaggggcacattgctcgagcagtgctc
gagagtatgtgctttcaggtgaatgatgtcctcagctccatgcacaaggatgctggggag
gcaggagaagtgaagagtgcagaaggggagttcctgctgcgcgttgatggtggtgctact
gtcaacaatcttctcatgcagatccaggctgatttattgggtagccctgttgtcagacct
gctgacatcgagacaactgcccttggagctgcgtatgcagctggattagctgttggagtc
tggtcgaaggaacaaattttcgctggtttgcacaaggagaacaccagagtcttccgcccg
aaattggatgaggcccacaggaggaagagagcagactcctggtacaaggccgtttcaaga
tcatttgatttggctgacctttctctttag

DBGET integrated database retrieval system