KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337265Help
Entry
4337265           CDS       T01015                                 

Definition
Os04g0658000
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4337265
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     4337265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 344 aa AA seqDB search
MSSAASASAAGGAGEEGAAAAAQPQQEGPVVTCKGVNGLDKVVLREVRGSSAEVYLYGGH
VTSWKDEHGEELLFVSNKAIFKPPKAIRGGIPICFPQFSNFGNLDPHGFARNRTWSVEND
PPPFPVPTSNKAYVDLILTHTEEDLKIWPHSYEFRLRVALGPGGDLMLTSRIRNTNADGK
PFSFTFAYHTYFSISDISEVRVEGLETLDYLDNLQERNRYTEQGDAIVFESELDRIYLGT
PSKIAIIDHEKKRTFVVRKGGLPDAVVWNPWDKKAKAMSDFGDDEYKRMVCVEAAAIEKP
ITLKPGEEWTGKLELSAVPSSYYSGQLDPDRVLQDSSVPEDSIS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggcggcgtcggcgtcggcggccggaggggcaggcgaggagggcgccgccgcc
gccgcgcagccgcagcaggaggggccggtggtgacctgcaagggcgtgaacgggctcgac
aaggtcgtcctccgggaggtccgaggcagctctgccgaggtgtacctgtatggcggccat
gtcacatcatggaaagatgagcatggagaggagctgctttttgttagtaataaggctatt
ttcaaacctccaaaagctatacgtggagggataccaatctgctttcctcagttttccaac
ttcggaaatctggacccacatggctttgcaaggaacaggacctggagtgttgaaaatgat
ccaccaccatttccagtaccaacttctaataaagcttacgtcgatttaatccttacgcat
actgaagaagatctaaagatctggccacatagttacgagttccgtctgagagttgcactt
ggacctggtggagatctgatgctgacttcacgtataagaaataccaatgcagatggaaag
ccattctcatttacatttgcatatcacacatacttttcaatatctgatatcagcgaggtg
cgagtagaaggcctggaaactctggattacctagacaacttacaagagagaaatcgatac
actgaacaaggggatgcaattgtttttgaatctgaattggacagaatatatctgggcaca
ccgtcaaaaattgccattattgatcatgagaagaaaagaacatttgttgtgaggaaaggt
ggccttcctgatgctgttgtttggaacccttgggacaagaaggctaaggctatgtcagac
tttggggatgacgaatataaacgcatggtctgtgtggaggcagctgctatagaaaagccg
attactttgaagcctggtgaggagtggactggaaagttggaactgtctgctgtcccatct
agctattacagtggtcagctggatcctgatcgtgttcttcaggattcaagtgtcccggag
gactcaatcagctag

DBGET integrated database retrieval system